PDB entry 4g8e

View 4g8e on RCSB PDB site
Description: Crystal Structure of clone18 TCR
Class: immune system
Keywords: TCR, T cell, CD1b, GMM, lipid recognition, IMMUNE SYSTEM
Deposited on 2012-07-23, released 2013-05-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-07-10, with a file datestamp of 2013-07-05.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.244
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha chain clone 18 TCR
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4G8E (0-200)
    Domains in SCOPe 2.04: d4g8ea1, d4g8ea2
  • Chain 'B':
    Compound: beta chain clone 18 TCR
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4G8E (0-246)
    Domains in SCOPe 2.04: d4g8eb1, d4g8eb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4g8eA (A:)
    gqnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrf
    ssflsrskgysylllkelqmkdsasylcavlntggfktifgagtrlfvkaniqnpdpavy
    qlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksd
    facanafnnsiipedtffpsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4g8eB (B:)
    gvtqtpkfrvlktgqsmtllcaqdmnheymywyrqdpgmglrlihysvgegttakgevpd
    gynvsrlkkqnfllglesaapsqtsvyfcasrppltarglkhtgelffgegsrltvledl
    knvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqpl
    keqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsa
    eawgrad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g8eB (B:)
    gvtqtpkfrvlktgqsmtllcaqdmnheymywyrqdpgmglrlihysvgegttakgevpd
    gynvsrlkkqnfllglesaapsqtsvyfcasrpplttgelffgegsrltvledlknvfpp
    evavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpal
    ndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra
    d