PDB entry 4g7q

View 4g7q on RCSB PDB site
Description: Structure of Recombinant Cytochrome ba3 Oxidase mutant V236L from Thermus thermophilus
Class: oxidoreductase
Keywords: OXIDOREDUCTASE, Proton Pump
Deposited on 2012-07-20, released 2013-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.178
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c oxidase subunit 1
    Species: Thermus thermophilus [TaxId:300852]
    Gene: cbaA, TTHA1135
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SJ79 (Start-568)
      • engineered mutation (126)
      • engineered mutation (242)
    Domains in SCOPe 2.07: d4g7qa_
  • Chain 'B':
    Compound: Cytochrome c oxidase subunit 2
    Species: Thermus thermophilus [TaxId:300852]
    Gene: cbaB, ctaC, TTHA1134
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4g7qb1, d4g7qb2
  • Chain 'C':
    Compound: Cytochrome c oxidase polypeptide 2A
    Species: Thermus thermophilus [TaxId:300852]
    Gene: cbaD, TTHA1133
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4g7qc_
  • Heterogens: CU, HEM, HAS, PER, OLC, CUA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4g7qA (A:)
    mhhhhhhhavraseisrvyeaypekkatlyflvlgflalivgslfgpfqalnygnvdayp
    llkrllpfvqsyyqgltlhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwma
    figlvvfalpllaneatvlytfypplkghwafylgasvfvlstwvsiyivldlwrrwkaa
    npgkvtplvtymavvfwlmwflaslglvleavlfllpwsfglvegvdplvartlfwwtgh
    pilyfwllpayaiiytilpkqaggklvsdpmarlafllflllstpvgfhhqfadpgidpt
    wkmihsvltlfvavpslmtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgl
    lgfipggaggivnasftldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpi
    sdaqrrlglavvwlwflgmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvla
    givllvalllfiyglfsvllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfav
    aailvvlaygptlvqlfghlnpvpgwrlw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g7qA (A:)
    srvyeaypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsyyqg
    ltlhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvfalpllane
    atvlytfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtymavv
    fwlmwflaslglvleavlfllpwsfglvegvdplvartlfwwtghpilyfwllpayaiiy
    tilpkqaggklvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfvavp
    slmtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggivnas
    ftldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavvwlw
    flgmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfiygl
    fsvllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygptlvq
    lfghlnpvpgwrlw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4g7qB (B:)
    mvdehkahkailayekgwlafslamlfvfialiaytlathtagvipagklervdpttvrq
    egpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfkitspdvihgfhveg
    tninvevlpgevstvrytfkrpgeyriicnqycglghqnmfgtivvke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g7qB (B:)
    dehkahkailayekgwlafslamlfvfialiaytlathtagvipagklervdpttvrqeg
    pwadpaqavvqtgpnqytvyvlafafgyqpnpievpqgaeivfkitspdvihgfhvegtn
    invevlpgevstvrytfkrpgeyriicnqycglghqnmfgtivvke
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4g7qC (C:)
    meekpkgalavilvltltilvfwlgvyavffarg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g7qC (C:)
    ekpkgalavilvltltilvfwlgvyavffarg