PDB entry 4g59

View 4g59 on RCSB PDB site
Description: Crystal structure of the murine cytomegalovirus MHC-I homolog m152 with ligand RAE-1 gamma
Class: immune system
Keywords: MHC-I Fold, Immunoevasion, Stress induced ligand, IMMUNE SYSTEM
Deposited on 2012-07-17, released 2012-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: 0.203
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinoic acid early-inducible protein 1-gamma
    Species: Mus musculus [TaxId:10090]
    Gene: Raet1c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4g59a_
  • Chain 'B':
    Compound: Retinoic acid early-inducible protein 1-gamma
    Species: Mus musculus [TaxId:10090]
    Gene: Raet1c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4g59b_
  • Chain 'C':
    Compound: M152 protein
    Species: Murid herpesvirus 1 [TaxId:10366]
    Gene: m152
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: M152 protein
    Species: Murid herpesvirus 1 [TaxId:10366]
    Gene: m152
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4g59A (A:)
    mlddahslrcnltikaptpadplwyeakclvdeililhlsninktmtsgdpgetanatev
    gecltqpvndlcqklrdkvsntkvdthktngyphlqvtmiypqsqgqtpsatwefnisds
    yfftfytenmswrsandesgvimnkwnddgdlvqrlkyfipecrqkideflkqskekprs
    tsrspsitqltstsplpppshstsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g59A (A:)
    ahslrcnltikaptpadplwyeakclvdeililhlsninkanatevgecltqpvndlcqk
    lrdkvsntkvdthktngyphlqvtmiypqsqgqtpsatwefnisdsyfftfytenmswrs
    andesgvimnkwnddgdlvqrlkyfipecrqkideflkqske
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4g59B (B:)
    mlddahslrcnltikaptpadplwyeakclvdeililhlsninktmtsgdpgetanatev
    gecltqpvndlcqklrdkvsntkvdthktngyphlqvtmiypqsqgqtpsatwefnisds
    yfftfytenmswrsandesgvimnkwnddgdlvqrlkyfipecrqkideflkqskekprs
    tsrspsitqltstsplpppshstsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g59B (B:)
    ahslrcnltikaptpadplwyeakclvdeililhlsninktanatevgecltqpvndlcq
    klrdkvsntkvdthktngyphlqvtmiypqsqgqtpsatwefnisdsyfftfytenmswr
    sandesgvimnkwnddgdlvqrlkyfipecrqkideflkqske
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.