PDB entry 4g1f

View 4g1f on RCSB PDB site
Description: Crystal Structure of human Dipeptidyl Peptidase IV in complex with a pyridopyrimidinedione analogue
Class: hydrolase/hydrolase inhibitor
Keywords: protease, 8-bladed beta-propeller domain, Aminopeptidase, Cell membrane, Glycoprotein, Hydrolase, Secreted, Serine protease, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2012-07-10, released 2013-02-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-02-27, with a file datestamp of 2013-02-22.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.209
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dipeptidyl peptidase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: ADCP2, CD26, DPP4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4g1fa1, d4g1fa2
  • Chain 'B':
    Compound: dipeptidyl peptidase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: ADCP2, CD26, DPP4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27487 (12-739)
      • expression tag (11)
    Domains in SCOPe 2.06: d4g1fb1, d4g1fb2, d4g1fb3
  • Chain 'C':
    Compound: dipeptidyl peptidase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: ADCP2, CD26, DPP4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4g1fc1, d4g1fc2
  • Chain 'D':
    Compound: dipeptidyl peptidase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: ADCP2, CD26, DPP4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4g1fd1, d4g1fd2
  • Heterogens: 0WG, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4g1fA (A:)
    adpggshhhhhhsrktytltdylkntyrlklyslrwisdheylykqennilvfnaeygns
    svflenstfdefghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqlitee
    ripnntqwvtwspvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeee
    vfsaysalwwspngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptv
    kffvvntdslssvtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmd
    icdydessgrwnclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicy
    fqidkkdctfitkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtcls
    celnpercqyysvsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqn
    vqmpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwaty
    lasteniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriai
    wgwsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrns
    tvmsraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasst
    ahqhiythmshfikqcfslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g1fA (A:)
    ktytltdylkntyrlklyslrwisdheylykqnilvfnaeygnssvflenstfdefghsi
    ndysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwspvgh
    klayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspngtf
    layaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssvtna
    tsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnclva
    rqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitkgtw
    evigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysvsfs
    keakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfiilnet
    kfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasfdgrg
    sgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsmvlgs
    gsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqveyll
    ihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshfikqc
    fslp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4g1fB (B:)
    adpggshhhhhhsrktytltdylkntyrlklyslrwisdheylykqennilvfnaeygns
    svflenstfdefghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqlitee
    ripnntqwvtwspvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeee
    vfsaysalwwspngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptv
    kffvvntdslssvtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmd
    icdydessgrwnclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicy
    fqidkkdctfitkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtcls
    celnpercqyysvsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqn
    vqmpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwaty
    lasteniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriai
    wgwsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrns
    tvmsraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasst
    ahqhiythmshfikqcfslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g1fB (B:)
    hsrktytltdylkntyrlklyslrwisdheylykqnilvfnaeygnssvflenstfdefg
    hsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwsp
    vghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspn
    gtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssv
    tnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnc
    lvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitk
    gtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysv
    sfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfiil
    netkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasfd
    grgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsmv
    lgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqve
    yllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshfi
    kqcfslp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4g1fC (C:)
    adpggshhhhhhsrktytltdylkntyrlklyslrwisdheylykqennilvfnaeygns
    svflenstfdefghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqlitee
    ripnntqwvtwspvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeee
    vfsaysalwwspngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptv
    kffvvntdslssvtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmd
    icdydessgrwnclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicy
    fqidkkdctfitkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtcls
    celnpercqyysvsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqn
    vqmpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwaty
    lasteniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriai
    wgwsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrns
    tvmsraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasst
    ahqhiythmshfikqcfslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g1fC (C:)
    ktytltdylkntyrlklyslrwisdheylykqnilvfnaenssvflenstfdefghsind
    ysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwspvghkl
    ayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspngtfla
    yaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssvtnats
    iqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnclvarq
    hiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitkgtwev
    igiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysvsfske
    akyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfiilnetkf
    wyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasfdgrgsg
    yqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsmvlgsgs
    gvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqveyllih
    gtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshfikqcfs
    lp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4g1fD (D:)
    adpggshhhhhhsrktytltdylkntyrlklyslrwisdheylykqennilvfnaeygns
    svflenstfdefghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqlitee
    ripnntqwvtwspvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeee
    vfsaysalwwspngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptv
    kffvvntdslssvtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmd
    icdydessgrwnclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicy
    fqidkkdctfitkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtcls
    celnpercqyysvsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqn
    vqmpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwaty
    lasteniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriai
    wgwsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrns
    tvmsraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasst
    ahqhiythmshfikqcfslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4g1fD (D:)
    ktytltdylkntyrlklyslrwisdheylykqnilvfnanssvfdefghsindysispdg
    qfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwspvghklayvwnnd
    iyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspngtflayaqfndt
    evplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssvtnatsiqitapa
    smligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnclvarqhiemstt
    gwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitkgtwevigiealt
    sdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysvsfskeakyyqlr
    csgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfiilnetkfwyqmilp
    phfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasfdgrgsgyqgdkim
    hainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsmvlgsgsgvfkcgi
    avapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqveyllihgtaddnv
    hfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshfikqcfslp