PDB entry 4g01

View 4g01 on RCSB PDB site
Description: ARA7-GDP-Ca2+/VPS9a
Class: transport protein
Keywords: GTPase-GDP-metal-GEF complex, vps9 domain, Ras super family, guanine nucleotide exchange factor, small GTPase, GDP/GTP binding, divalent metal binding, geranylgeranylation, TRANSPORT PROTEIN
Deposited on 2012-07-09, released 2013-02-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.202
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vacuolar protein sorting-associated protein 9A
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: VPS9A
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ras-related protein RABF2b
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ARA-7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4g01b_
  • Heterogens: CA, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4g01B (B:)
gsmaaagnksinaklvllgdvgagksslvlrfvkdqfvefqestigaaffsqtlavndat
vkfeiwdtagqeryhslapmyyrgaaaaiivfdvtnqasferakkwvqelqaqgnpnmvm
alagnksdlldarkvtaedaqtyaqenglffmetsaktatnvkeifyeiarrlprvqpte
n

    Sequence, based on observed residues (ATOM records): (download) 
    >4g01B (B:)
sinaklvllgdvgagksslvlrfvkdqfvefqestigaaffsqtlavndatvkfeiwdta
gqeryhslapmyyrgaaaaiivfdvtnqasferakkwvqelqaqgnpnmvmalagnksdl
ldarkvtaedaqtyaqenglffmetsaktatnvkeifyeiarrlp