PDB entry 4fz8

View 4fz8 on RCSB PDB site
Description: Crystal structure of C11 Fab, an ADCC mediating anti-HIV-1 antibody.
Class: immune system
Keywords: adcc, anti-hiv-1 env antibody c11, cd4i antibody, fab, viral glycoprotein gp120, hiv-1 env, immune system
Deposited on 2012-07-06, released 2013-07-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-07-10, with a file datestamp of 2013-07-05.
Experiment type: XRAY
Resolution: 2.66 Å
R-factor: 0.256
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: FAB heavy chain of human ANTI-HIV-1 ENV ANTIBODY C11
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FZ8 (0-End)
  • Chain 'L':
    Compound: FAB light chain of human ANTI-HIV-1 ENV ANTIBODY C11
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FZ8 (0-End)
    Domains in SCOPe 2.04: d4fz8l1, d4fz8l2
  • Heterogens: NAG, ZN, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4fz8L (L:)
    divmtqsplslpvtpgepasiscrssqsllhsngynyldwylqkpgqspqlliylgsnra
    sgvpdrfigsgsgtdftlkisrveaedvgvfycmqalqavgfgpgtkveikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fz8L (L:)
    divmtqsplslpvtpgepasiscrssqsllhsngynyldwylqkpgqspqlliylgsnra
    sgvpdrfigsgsgtdftlkisrveaedvgvfycmqalqavgfgpgtkveikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnr