PDB entry 4fxw

View 4fxw on RCSB PDB site
Description: Structure of phosphorylated SF1 complex with U2AF65-UHM domain
Class: protein binding
Keywords: UHM, pre-mRNA splicing factor, protein binding, phosphorylation
Deposited on 2012-07-03, released 2013-01-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-02-27, with a file datestamp of 2013-02-22.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: 0.251
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: splicing factor u2af 65 kda subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: U2AF2, U2AF65
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26368 (5-105)
      • expression tag (1-4)
    Domains in SCOPe 2.06: d4fxwa1, d4fxwa2
  • Chain 'B':
    Compound: Splicing factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SF1, ZFM1, ZNF162
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: splicing factor u2af 65 kda subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: U2AF2, U2AF65
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26368 (5-105)
      • expression tag (1-4)
    Domains in SCOPe 2.06: d4fxwc1, d4fxwc2
  • Chain 'D':
    Compound: Splicing factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SF1, ZFM1, ZNF162
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fxwA (A:)
    gplgstevlclmnmvlpeellddeeyeeivedvrdecskyglvksieiprpvdgvevpgc
    gkifveftsvfdcqkamqgltgrkfanrvvvtkycdpdsyhrrdfw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fxwA (A:)
    plgstevlclmnmvlpeellddeeyeeivedvrdecskyglvksieiprpvdgvevpgcg
    kifveftsvfdcqkamqgltgrkfanrvvvtkycdpdsyhrrdfw
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4fxwC (C:)
    gplgstevlclmnmvlpeellddeeyeeivedvrdecskyglvksieiprpvdgvevpgc
    gkifveftsvfdcqkamqgltgrkfanrvvvtkycdpdsyhrrdfw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fxwC (C:)
    plgstevlclmnmvlpeellddeeyeeivedvrdecskyglvksieiprpdgvevpgcgk
    ifveftsvfdcqkamqgltgrkfanrvvvtkycdpdsyhrrdfw
    

  • Chain 'D':
    No sequence available.