PDB entry 4fxv

View 4fxv on RCSB PDB site
Description: Crystal structure of an ELAV-like protein 1 (ELAVL1) from Homo sapiens at 1.90 A resolution
Class: RNA binding protein, transcription
Keywords: RNA recognition motif, putative RNA-binding domain, transcription, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-BIOLOGY, RNA BINDING PROTEIN, Partnership for T-Cell Biology, TCELL
Deposited on 2012-07-03, released 2012-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ELAV-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BC003376, ELAVL1, HUR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15717 (19-98)
      • expression tag (15-18)
    Domains in SCOPe 2.07: d4fxva1, d4fxva2
  • Chain 'B':
    Compound: ELAV-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BC003376, ELAVL1, HUR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15717 (19-End)
      • expression tag (16-18)
    Domains in SCOPe 2.07: d4fxvb1, d4fxvb2
  • Chain 'C':
    Compound: ELAV-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BC003376, ELAVL1, HUR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15717 (19-98)
      • expression tag (15-18)
    Domains in SCOPe 2.07: d4fxvc1, d4fxvc2
  • Chain 'D':
    Compound: ELAV-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BC003376, ELAVL1, HUR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15717 (19-End)
      • expression tag (18)
    Domains in SCOPe 2.07: d4fxvd1, d4fxvd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fxvA (A:)
    mgsdkihhhhhhenlyfqgtnlivnylpqnmtqdelrslfssigevesaklirdkvaghs
    lgygfvnyvtakdaeraintlnglrlqsktikvsyarps
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fxvA (A:)
    yfqgtnlivnylpqnmtqdelrslfssigevesaklirdkvaghslgygfvnyvtakdae
    raintlnglrlqsktikvsyarps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4fxvB (B:)
    mgsdkihhhhhhenlyfqgtnlivnylpqnmtqdelrslfssigevesaklirdkvaghs
    lgygfvnyvtakdaeraintlnglrlqsktikvsyarps
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fxvB (B:)
    fqgtnlivnylpqnmtqdelrslfssigevesaklirdkvaghslgygfvnyvtakdaer
    aintlnglrlqsktikvsyar
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4fxvC (C:)
    mgsdkihhhhhhenlyfqgtnlivnylpqnmtqdelrslfssigevesaklirdkvaghs
    lgygfvnyvtakdaeraintlnglrlqsktikvsyarps
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fxvC (C:)
    yfqgtnlivnylpqnmtqdelrslfssigevesaklirdkghslgygfvnyvtakdaera
    intlnglrlqsktikvsyarps
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4fxvD (D:)
    mgsdkihhhhhhenlyfqgtnlivnylpqnmtqdelrslfssigevesaklirdkvaghs
    lgygfvnyvtakdaeraintlnglrlqsktikvsyarps
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fxvD (D:)
    gtnlivnylpqnmtqdelrslfssigevesaklirdkvaghslgygfvnyvtakdaerai
    ntlnglrlqsktikvsya