PDB entry 4fxc

View 4fxc on RCSB PDB site
Description: tertiary structure of [2fe-2s] ferredoxin from spirulina platensis refined at 2.5 angstroms resolution: structural comparisons of plant-type ferredoxins and an electrostatic potential analysis
Class: electron transport
Keywords: electron transport
Deposited on 1995-04-25, released 1995-12-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.199
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ferredoxin
  Species: Arthrospira platensis [TaxId:118562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00246 (0-97)
  Domains in SCOPe 2.06: d4fxca_
• Heterogens: FES, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4fxcA (A:)
  atykvtlineaeginetidcdddtyildaaeeagldlpyscragacstcagtitsgtidq
  sdqsfldddqieagyvltcvayptsdctikthqeegly