PDB entry 4fqz

View 4fqz on RCSB PDB site
Description: Crystal structure of a protease-resistant mutant form of human galectin-8
Class: sugar binding protein
Keywords: Carbohydrate/Sugar binding, SUGAR BINDING PROTEIN
Deposited on 2012-06-26, released 2012-07-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-07-03, with a file datestamp of 2013-06-28.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.209
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-8
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS8
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00214 (0-154)
      • linker (155-156)
    • Uniprot O00214 (157-290)
    Domains in SCOPe 2.06: d4fqza1, d4fqza2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4fqzA (A:)
mmlslnnlqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssmkpra
dvafhfnprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavng
khtllyghrigpekidtlgiygkvnihsigfsfsshmrlpfaarlntpmgpgrtvvvkge
vnanaksfnvdllagkskdialhlnprlnikafvrnsflqeswgeeernitsfpfspgmy
femiiycdvrefkvavngvhsleykhrfkelssidtleingdihllevrsw