PDB entry 4fqx

View 4fqx on RCSB PDB site
Description: Crystal structure of HLA-DM bound to HLA-DR1
Class: immune system
Keywords: immune complex, peptide loading, peptide editing, antigen presentation, IMMUNE SYSTEM
Deposited on 2012-06-25, released 2013-01-09
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-01-09, with a file datestamp of 2013-01-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.196
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hla class II histocompatibility antigen, dr alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DR1 alpha chain, HLA-DRA, HLA-DRA1, MHC CLASS II MOLECULE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01903
      • engineered mutation (64)
    Domains in SCOPe 2.03: d4fqxa1, d4fqxa2
  • Chain 'B':
    Compound: HLA class II histocompatibility antigen, DRB1-1 beta chain
    Species: Homo sapiens [TaxId:9606]
    Gene: beta chain, HLA-DR1, HLA-DRB1, MHC CLASS II MOLECULE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04229 (6-End)
      • expression tag (0-5)
      • engineered mutation (35)
    Domains in SCOPe 2.03: d4fqxb1, d4fqxb2
  • Chain 'C':
    Compound: HLA class II histocompatibility antigen, DM alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: DM alpha chain, DMA, HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, HLA-DMA, RING6
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28067 (Start-198)
      • variant (135-136)
      • engineered mutation (164)
      • expression tag (199)
    Domains in SCOPe 2.03: d4fqxc1, d4fqxc2
  • Chain 'D':
    Compound: HLA class II histocompatibility antigen, DM beta chain
    Species: Homo sapiens [TaxId:9606]
    Gene: DM beta chain, DMB, HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, HLA-DMB, RING7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28068 (Start-192)
      • engineered mutation (45)
      • engineered mutation (91)
    Domains in SCOPe 2.03: d4fqxd1, d4fqxd2
  • Chain 'E':
    Compound: synthetic peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 4FQX
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fqxA (A:)
    ikeehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgal
    aniacdkanleimtkrsnytpitnvppevtvltnspvelrepnvlicfidkftppvvnvt
    wlrngkpvttgvsetvflpredhlfrkfhylpflpstedvydcrvehwgldepllkhwef
    dapsplpette
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fqxA (A:)
    keehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgala
    niacdkanleimtkrsnytpitnvppevtvltnspvelrepnvlicfidkftppvvnvtw
    lrngkpvttgvsetvflpredhlfrkfhylpflpstedvydcrvehwgldepllkhwefd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4fqxB (B:)
    vlfqgpgdtrprflwqlkfechffngtervrllersiynqeesvrfdsdvgeyravtelg
    rpdaeywnsqkdlleqrraavdtycrhnygvgesftvqrrvepkvtvypsktqplqhhnl
    lvcsvsgfypgsievrwfrngqeekagvvstgliqngdwtfqtlvmletvprsgevytcq
    vehpsvtspltvewrarssgggslpatg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fqxB (B:)
    vlfqgpgdtrprflwqlkfechffngtervrllersiynqeesvrfdsdvgeyravtelg
    rpdaeywnsqkdlleqrraavdtycrhnygvgesftvqrrvepkvtvypsllvcsvsgfy
    pgsievrwfrngqeekagvvstgliqngdwtfqtlvmletvprsgevytcqvehpsvtsp
    ltvewra
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4fqxC (C:)
    vpeaptpmwpddlqnhtflhtvycqdgspsvglseaydedqlfffdfsqntrvprlpefa
    dwaqeqgdapailfdkefcewmiqqigpkldgkipvsrgfpiaevftlkplefgkpntlv
    cfvsnlfppmltvnwqhhsvpvegfgptfvsavdglsfqafsyldftpepsdifscivth
    eidrytaiaywvprnalpslvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fqxC (C:)
    nhtflhtvycqdgspsvglseaydedqlfffdfsqntrvprlpefadwaqeqgdapailf
    dkefcewmiqqigpkldgkipvsrgfpiaevftlkplefgkpntlvcfvsnlfppmltvn
    wqhhsvpvegfgptfvsavdglsfqafsyldftpepsdifscivtheidrytaiaywvpr
    nalpsl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4fqxD (D:)
    ggfvahvestcllddagtpkdftycisfnkdlltcwdpeenkmapsefgvlnslanvlsq
    hlnqkdtlmqrlrnglqncathtqpfwgsltdrtrppsvqvakttpfntrepvmlacyvw
    gfypaevtitwrkngklvmphssahktaqpngdwtyqtlshlaltpsygdtytcvvehig
    apepilrdwtpglgclvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fqxD (D:)
    fvahvestcllddagtpkdftycisfnkdlltcwdpeenkmapsefgvlnslanvlsqhl
    nqkdtlmqrlrnglqncathtqpfwgsltdrtrppsvqvakttpfntrepvmlacyvwgf
    ypaevtitwrkngklvmphssahktaqpngdwtyqtlshlaltpsygdtytcvvehigap
    epilrdwtpgl
    

  • Chain 'E':
    No sequence available.