PDB entry 4fqj

View 4fqj on RCSB PDB site
Description: Influenza B/Florida/4/2006 hemagglutinin Fab CR8071 complex
Class: viral protein/immune system
Keywords: monoclonal, immunoglobulin, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2012-06-25, released 2012-08-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-10-03, with a file datestamp of 2012-09-28.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.232
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza B virus [TaxId:1171632]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: antibody CR8071 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FQJ (0-End)
  • Chain 'L':
    Compound: antibody CR8071 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FQJ (0-End)
    Domains in SCOPe 2.04: d4fqjl1, d4fqjl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4fqjL (L:)
    qsvltqppsasgtpgqrvtiscsgsssnigtnyvywyqqfpgtapklliyrsyqrpsgvp
    drfsgsksgssaslaisglqsedeadyycatwddsldgwvfgggtkltvlrqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fqjL (L:)
    qsvltqppsasgtpgqrvtiscsgsssnigtnyvywyqqfpgtapklliyrsyqrpsgvp
    drfsgsksgssaslaisglqsedeadyycatwddsldgwvfgggtkltvlrqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptec