PDB entry 4fq2

View 4fq2 on RCSB PDB site
Description: Crystal Structure of 10-1074 Fab
Class: immune system
Keywords: ig fold, anti hiv, antibody, immune system
Deposited on 2012-06-24, released 2012-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-12-12, with a file datestamp of 2012-12-07.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.189
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FQ2 (0-End)
  • Chain 'L':
    Compound: Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FQ2
    Domains in SCOPe 2.07: d4fq2l1, d4fq2l2
  • Heterogens: 144, EDO, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4fq2L (L:)
    syvrplsvalgetariscgrqalgsravqwyqhrpgqapilliynnqdrpsgiperfsgt
    pdinfgtratltisgveagdeadyychmwdsrsgfswsfggatrltvlgqpkaapsvtlf
    ppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyl
    sltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fq2L (L:)
    vrplsvalgetariscgrqalgsravqwyqhrpgqapilliynnqdrpsgiperfsgtpd
    infgtratltisgveagdeadyychmwdsrsgfswsfggatrltvlgqpkaapsvtlfpp
    sseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassylsl
    tpeqwkshrsyscqvthegstvektvaptec