PDB entry 4fp8

View 4fp8 on RCSB PDB site
Description: Crystal structure of broadly neutralizing antibody C05 bound to H3 influenza hemagglutinin, HA1 subunit
Class: viral protein/immune system
Keywords: viral fusion protein, immunoglobulin, virus attachment and entry, immune recognition, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2012-06-21, released 2012-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-10, with a file datestamp of 2012-10-05.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.214
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:506350]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fp8a_
  • Chain 'B':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:506350]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fp8b_
  • Chain 'C':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:506350]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fp8c_
  • Chain 'D':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:506350]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fp8d_
  • Chain 'H':
    Compound: Antibody C05, Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FP8 (0-End)
  • Chain 'I':
    Compound: Antibody C05, Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FP8 (0-End)
  • Chain 'J':
    Compound: Antibody C05, Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FP8 (0-End)
  • Chain 'K':
    Compound: Antibody C05, Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FP8 (0-End)
  • Chain 'L':
    Compound: Antibody C05, Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FP8 (0-End)
    Domains in SCOPe 2.07: d4fp8l1, d4fp8l2
  • Chain 'M':
    Compound: Antibody C05, Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FP8 (0-End)
    Domains in SCOPe 2.07: d4fp8m1, d4fp8m2
  • Chain 'N':
    Compound: Antibody C05, Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FP8 (0-End)
    Domains in SCOPe 2.07: d4fp8n1, d4fp8n2
  • Chain 'O':
    Compound: Antibody C05, Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FP8 (0-End)
    Domains in SCOPe 2.07: d4fp8o1, d4fp8o2
  • Heterogens: NAG, ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fp8A (A:)
    adpgvqssstgkicnnphrildgidctlidallgdphcdvfqnetwdlfverskafsncy
    pydvpdyaslrslvassgtlefitegftwtgvtqnggsnackrgpgsgffsrlnwltksg
    stypvlnvtmpnndnfdklyiwgvhhpstnqeqtslyvqasgrvtvstrrsqqtiipnig
    srpwvrglssrisiywtivkpgdvlvinsngnliaprgyfkmrtgkssimrsdapidtci
    secitpngsipndkpfqnvnkitygacpkyvghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fp8A (A:)
    vqssstgkicnnphrildgidctlidallgdphcdvfqnetwdlfverskafsncypydv
    pdyaslrslvassgtlefitegftwtgvtqnggsnackrgpgsgffsrlnwltksgstyp
    vlnvtmpnndnfdklyiwgvhhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpw
    vrglssrisiywtivkpgdvlvinsngnliaprgyfkmrtgkssimrsdapidtciseci
    tpngsipndkpfqnvnkitygacpkyv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4fp8B (B:)
    adpgvqssstgkicnnphrildgidctlidallgdphcdvfqnetwdlfverskafsncy
    pydvpdyaslrslvassgtlefitegftwtgvtqnggsnackrgpgsgffsrlnwltksg
    stypvlnvtmpnndnfdklyiwgvhhpstnqeqtslyvqasgrvtvstrrsqqtiipnig
    srpwvrglssrisiywtivkpgdvlvinsngnliaprgyfkmrtgkssimrsdapidtci
    secitpngsipndkpfqnvnkitygacpkyvghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fp8B (B:)
    vqssstgkicnnphrildgidctlidallgdphcdvfqnetwdlfverskafsncypydv
    pdyaslrslvassgtlefitegftwtgvtqnggsnackrgpgsgffsrlnwltksgstyp
    vlnvtmpnndnfdklyiwgvhhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpw
    vrglssrisiywtivkpgdvlvinsngnliaprgyfkmrtgkssimrsdapidtciseci
    tpngsipndkpfqnvnkitygacpkyv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4fp8C (C:)
    adpgvqssstgkicnnphrildgidctlidallgdphcdvfqnetwdlfverskafsncy
    pydvpdyaslrslvassgtlefitegftwtgvtqnggsnackrgpgsgffsrlnwltksg
    stypvlnvtmpnndnfdklyiwgvhhpstnqeqtslyvqasgrvtvstrrsqqtiipnig
    srpwvrglssrisiywtivkpgdvlvinsngnliaprgyfkmrtgkssimrsdapidtci
    secitpngsipndkpfqnvnkitygacpkyvghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fp8C (C:)
    qssstgkicnnphrildgidctlidallgdphcdvfqnetwdlfverskafsncypydvp
    dyaslrslvassgtlefitegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypv
    lnvtmpnndnfdklyiwgvhhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwv
    rglssrisiywtivkpgdvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecit
    pngsipndkpfqnvnkitygacpky
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4fp8D (D:)
    adpgvqssstgkicnnphrildgidctlidallgdphcdvfqnetwdlfverskafsncy
    pydvpdyaslrslvassgtlefitegftwtgvtqnggsnackrgpgsgffsrlnwltksg
    stypvlnvtmpnndnfdklyiwgvhhpstnqeqtslyvqasgrvtvstrrsqqtiipnig
    srpwvrglssrisiywtivkpgdvlvinsngnliaprgyfkmrtgkssimrsdapidtci
    secitpngsipndkpfqnvnkitygacpkyvghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fp8D (D:)
    qssstgkicnnphrildgidctlidallgdphcdvfqnetwdlfverskafsncypydvp
    dyaslrslvassgtlefitegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypv
    lnvtmpnndnfdklyiwgvhhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwv
    rglssrisiywtivkpgdvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecit
    pngsipndkpfqnvnkitygacpkyv
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4fp8L (L:)
    diqltqspsslsasvgdrvtltcqasqdirkflnwyqqkpgkgpklliydasnlqrgvps
    rfsgggsgtdftliisslqpedvgtyycqqydglpftfgggtkvvikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fp8L (L:)
    diqltqspsslsasvgdrvtltcqasqdirkflnwyqqkpgkgpklliydasnlqrgvps
    rfsgggsgtdftliisslqpedvgtyycqqydglpftfgggtkvvikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4fp8M (M:)
    diqltqspsslsasvgdrvtltcqasqdirkflnwyqqkpgkgpklliydasnlqrgvps
    rfsgggsgtdftliisslqpedvgtyycqqydglpftfgggtkvvikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fp8M (M:)
    diqltqspsslsasvgdrvtltcqasqdirkflnwyqqkpgkgpklliydasnlqrgvps
    rfsgggsgtdftliisslqpedvgtyycqqydglpftfgggtkvvikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4fp8N (N:)
    diqltqspsslsasvgdrvtltcqasqdirkflnwyqqkpgkgpklliydasnlqrgvps
    rfsgggsgtdftliisslqpedvgtyycqqydglpftfgggtkvvikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fp8N (N:)
    diqltqspsslsasvgdrvtltcqasqdirkflnwyqqkpgkgpklliydasnlqrgvps
    rfsgggsgtdftliisslqpedvgtyycqqydglpftfgggtkvvikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4fp8O (O:)
    diqltqspsslsasvgdrvtltcqasqdirkflnwyqqkpgkgpklliydasnlqrgvps
    rfsgggsgtdftliisslqpedvgtyycqqydglpftfgggtkvvikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fp8O (O:)
    diqltqspsslsasvgdrvtltcqasqdirkflnwyqqkpgkgpklliydasnlqrgvps
    rfsgggsgtdftliisslqpedvgtyycqqydglpftfgggtkvvikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge