PDB entry 4fo6

View 4fo6 on RCSB PDB site
Description: Crystal structure of the pre-catalytic ternary complex of polymerase lambda with a dATP analog opposite a templating T and an rCMP at the primer terminus.
Class: transferase, lyase/DNA
Keywords: DNA polymerase, TRANSFERASE, LYASE-DNA complex
Deposited on 2012-06-20, released 2012-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-07-11, with a file datestamp of 2012-07-06.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.192
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase lambda
    Species: Homo sapiens [TaxId:9606]
    Gene: POLL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UGP5 (Start-328)
      • see remark 999 (221-224)
      • engineered mutation (296)
    Domains in SCOPe 2.07: d4fo6a1, d4fo6a2, d4fo6a3
  • Chain 'D':
    Compound: 5'-d(p*gp*cp*cp*g)-3'
  • Chain 'H':
    Compound: 5'-d(p*tp*ap*cp*tp*g)-3'
  • Chain 'I':
    Compound: 5'-d(p*cp*ap*gp*tp*a)-3'
  • Chain 'P':
    Compound: 5'-d(*cp*ap*gp*tp*ap)-r(p*c)-3'
  • Chain 'T':
    Compound: 5'-d(*cp*gp*gp*cp*tp*gp*tp*ap*cp*tp*g)-3'
  • Heterogens: MG, NA, CL, MN, F2A, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fo6A (A:)
    aqpssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacs
    ipgigkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsle
    dirsqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrg
    katcgdvdvlithpdgrshrgifsrlldslrqegfltddlvkgetkylgvcrlpgpgrrh
    rrldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgakvg
    pgrvlptptekdvfrllglpyrepaerdw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fo6A (A:)
    hnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrmae
    kiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledirsqasltt
    qqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdvdvl
    ithpdggifsrlldslrqegfltddlvkgetkylgvcrlpgpgrrhrrldiivvpysefa
    callyftgsahfnrsmralaktkgmslsehalstavvrnthgakvgpgrvlptptekdvf
    rllglpyrepaerdw
    

  • Chain 'D':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.