PDB entry 4fnl

View 4fnl on RCSB PDB site
Description: Crystal structure of broadly neutralizing antibody C05
Class: immune system
Keywords: Immunoglobulin, immune recognition, IMMUNE SYSTEM
Deposited on 2012-06-19, released 2012-09-19
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-10-10, with a file datestamp of 2012-10-05.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.214
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Antibody C05, Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FNL (0-End)
  • Chain 'I':
    Compound: Antibody C05, Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FNL (0-End)
  • Chain 'L':
    Compound: Antibody C05, Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FNL (0-End)
    Domains in SCOPe 2.04: d4fnll1, d4fnll2
  • Chain 'M':
    Compound: Antibody C05, Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FNL (0-End)
    Domains in SCOPe 2.04: d4fnlm1, d4fnlm2
  • Heterogens: TRS, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4fnlL (L:)
    diqltqspsslsasvgdrvtltcqasqdirkflnwyqqkpgkgpklliydasnlqrgvps
    rfsgggsgtdftliisslqpedvgtyycqqydglpftfgggtkvvikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fnlL (L:)
    diqltqspsslsasvgdrvtltcqasqdirkflnwyqqkpgkgpklliydasnlqrgvps
    rfsgggsgtdftliisslqpedvgtyycqqydglpftfgggtkvvikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4fnlM (M:)
    diqltqspsslsasvgdrvtltcqasqdirkflnwyqqkpgkgpklliydasnlqrgvps
    rfsgggsgtdftliisslqpedvgtyycqqydglpftfgggtkvvikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fnlM (M:)
    diqltqspsslsasvgdrvtltcqasqdirkflnwyqqkpgkgpklliydasnlqrgvps
    rfsgggsgtdftliisslqpedvgtyycqqydglpftfgggtkvvikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge