PDB entry 4fmc

View 4fmc on RCSB PDB site
Description: EspG-Rab1 complex
Class: protein binding
Keywords: alpha-beta fold, Rab1-GAP, Rab1, PROTEIN BINDING
Deposited on 2012-06-16, released 2012-09-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-10-03, with a file datestamp of 2012-09-28.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.227
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ROrf2
    Species: Escherichia coli [TaxId:562]
    Gene: EspG, rorf2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O52121 (0-350)
      • see remark 999 (76)
      • see remark 999 (197)
      • see remark 999 (222)
      • see remark 999 (329)
  • Chain 'B':
    Compound: Ras-related protein Rab-1A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB1, RAB1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4fmcb_
  • Chain 'C':
    Compound: ROrf2
    Species: Escherichia coli [TaxId:562]
    Gene: EspG, rorf2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O52121 (Start-350)
      • see remark 999 (76)
      • see remark 999 (197)
      • see remark 999 (222)
      • see remark 999 (329)
  • Chain 'D':
    Compound: Ras-related protein Rab-1A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB1, RAB1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4fmcd_
  • Chain 'E':
    Compound: ROrf2
    Species: Escherichia coli [TaxId:562]
    Gene: EspG, rorf2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O52121 (0-End)
      • see remark 999 (76)
      • see remark 999 (197)
      • see remark 999 (222)
  • Chain 'F':
    Compound: Ras-related protein Rab-1A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB1, RAB1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62820 (0-101)
      • expression tag (114-116)
  • Heterogens: PGE, AF3, GDP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fmcB (B:)
    peydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktiklqiw
    dtagqerfrtitssyyrgahgiivvydvtdqesfnnvkqwlqeidryasenvnkllvgnk
    cdlttkkvvdyttakefadslgipfletsaknatnveqsfmtmaaeikkrm
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fmcD (D:)
    peydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktiklqiw
    dtagqerfrtitssyyrgahgiivvydvtdqesfnnvkqwlqeidryasenvnkllvgnk
    cdlttkkvvdyttakefadslgipfletsaknatnveqsfmtmaaeikkrm
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.