PDB entry 4fmc
View 4fmc on RCSB PDB site
Description: EspG-Rab1 complex
Class: protein binding
Keywords: alpha-beta fold, Rab1-GAP, Rab1, PROTEIN BINDING
Deposited on
2012-06-16, released
2012-09-05
The last revision prior to the SCOPe 2.06 freeze date was dated
2012-10-03, with a file datestamp of
2012-09-28.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.227
AEROSPACI score: 0.24
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: ROrf2
Species: Escherichia coli [TaxId:562]
Gene: EspG, rorf2
Database cross-references and differences (RAF-indexed):
- Uniprot O52121 (0-350)
- see remark 999 (76)
- see remark 999 (197)
- see remark 999 (222)
- see remark 999 (329)
- Chain 'B':
Compound: Ras-related protein Rab-1A
Species: Homo sapiens [TaxId:9606]
Gene: RAB1, RAB1A
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d4fmcb_ - Chain 'C':
Compound: ROrf2
Species: Escherichia coli [TaxId:562]
Gene: EspG, rorf2
Database cross-references and differences (RAF-indexed):
- Uniprot O52121 (Start-350)
- see remark 999 (76)
- see remark 999 (197)
- see remark 999 (222)
- see remark 999 (329)
- Chain 'D':
Compound: Ras-related protein Rab-1A
Species: Homo sapiens [TaxId:9606]
Gene: RAB1, RAB1A
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d4fmcd_ - Chain 'E':
Compound: ROrf2
Species: Escherichia coli [TaxId:562]
Gene: EspG, rorf2
Database cross-references and differences (RAF-indexed):
- Uniprot O52121 (0-End)
- see remark 999 (76)
- see remark 999 (197)
- see remark 999 (222)
- Chain 'F':
Compound: Ras-related protein Rab-1A
Species: Homo sapiens [TaxId:9606]
Gene: RAB1, RAB1A
Database cross-references and differences (RAF-indexed):
- Heterogens: PGE, AF3, GDP, MG, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>4fmcB (B:)
peydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktiklqiw
dtagqerfrtitssyyrgahgiivvydvtdqesfnnvkqwlqeidryasenvnkllvgnk
cdlttkkvvdyttakefadslgipfletsaknatnveqsfmtmaaeikkrm
- Chain 'C':
No sequence available.
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>4fmcD (D:)
peydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktiklqiw
dtagqerfrtitssyyrgahgiivvydvtdqesfnnvkqwlqeidryasenvnkllvgnk
cdlttkkvvdyttakefadslgipfletsaknatnveqsfmtmaaeikkrm
- Chain 'E':
No sequence available.
- Chain 'F':
No sequence available.