PDB entry 4flr

View 4flr on RCSB PDB site
Description: Crystal structure of Amylosucrase double mutant A289P-F290L from Neisseria polysaccharea
Class: transferase
Keywords: beta/alpha-barrel, glycoside hydrolase, amylose synthesis, sucrose isomerization, glucosyltransferase, carbohydrate, transferase
Deposited on 2012-06-15, released 2012-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-02, with a file datestamp of 2012-12-28.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.188
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amylosucrase
    Species: Neisseria polysaccharea [TaxId:489]
    Gene: ams
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZEU2 (4-627)
      • expression tag (0-3)
      • engineered mutation (288-289)
      • cloning artifact (536)
    Domains in SCOPe 2.07: d4flra1, d4flra2, d4flra3
  • Heterogens: TRS, GOL, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4flrA (A:)
    spnsqylktrildiytpeqragieksedwrqfsrrmdthfpklmneldsvygnneallpm
    lemllaqawqsysqrnsslkdidiarennpdwilsnkqvggvcyvdlfagdlkglkdkip
    yfqelgltylhlmplfkcpegksdggyavssyrdvnpalgtigdlreviaalheagisav
    vdfifnhtsnehewaqrcaagdplfdnfyyifpdrrmpdqydrtlreifpdqhpggfsql
    edgrwvwttfnsfqwdlnysnpwvframagemlflanlgvdilrmdavpliwkqmgtsce
    nlpqahalirafnavmriaapavffkseaivhpdqvvqyigqdecqigynplqmallwnt
    latrevnllhqaltyrhnlpehtawvnyvrshddigwtfadedaaylgisgydhrqflnr
    ffvnrfdgsfargvpfqynpstgdcrvsgtaaalvglaqddphavdrikllysialstgg
    lpliylgdevgtlndddwsqdsnksddsrwahrprynealyaqrndpstaagqiyqdlrh
    miavrqsnprfdggrlvtfntnnkhiigyirnnallafgnfseypqtvtahtlqampfka
    hdliggktvslnqdltlqpyqvmwleia