PDB entry 4flh

View 4flh on RCSB PDB site
Description: Crystal structure of human PI3K-gamma in complex with AMG511
Class: Transferase/Inhibitor
Keywords: p110, phosphotransferase, cancer, p85, phosphorylation, Transferase-Inhibitor complex
Deposited on 2012-06-14, released 2012-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: PIK3CG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4flha1, d4flha2, d4flha3, d4flha4
  • Heterogens: SO4, 14K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4flhA (A:)
    gseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
    tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdip
    esqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkee
    wplvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprntdltvf
    veaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapals
    skasaespsseskgkvqllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgsfnadkl
    tsatnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqleaiiatd
    plnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwdqsal
    dvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfll
    krglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqvieml
    qkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagalaiekck
    vmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldl
    cllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspteekfq
    aaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksflginker
    vpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpql
    tskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikqgekhsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4flhA (A:)
    eesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvts
    kplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftdfvlrvcgrdeylv
    getpiknfqwvrhclkngeeihvvldtppdpaldevrkevslwdcdrkfrvkirgidipv
    ldltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycg
    kvqllyyvnlllidhrfllrrgeyvlhmwqissfnadkltsatnpdkensmsisilldpi
    alpkhqempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwg
    qqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhy
    llqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavilea
    ylrgcgtamlhdftqqvqviemlqkvtldikslsaedvssqvisqlkqklenlqnsqlpe
    sfrvpydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqd
    mlilqilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntga
    fkdevlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlf
    hidfghikervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfs
    mmlmtgmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvl