PDB entry 4fkm

View 4fkm on RCSB PDB site
Description: Structure of unliganded and reductively methylated FhuD2 from staphylococcus aureus
Class: metal binding protein
Keywords: Class III Solute Binding Protein, membrane protein, transport of hydroxamate siderophores, Reductive methylation of lysyl residues, METAL BINDING PROTEIN
Deposited on 2012-06-13, released 2013-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-06-04, with a file datestamp of 2014-05-30.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.216
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Similar to ferric hydroxamate receptor 1
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: SAV2284
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fkma_
  • Chain 'B':
    Compound: Similar to ferric hydroxamate receptor 1
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: SAV2284
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fkmb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fkmA (A:)
    gspkdpkriavvaptyagglkklganivavnqqvdqskvlkdkfkgvtkigdgdvekvak
    ekpdliivystdkdikkyqkvaptvvvdynkhkyleqqemlgkivgkedkvkawkkdwee
    ttakdgkeikkaigqdatvslfdefdkklytygdnwgrggevlyqafglkmqpeqqklta
    kagwaevkqeeiekyagdyivstsegkptpgyestnmwknlkatkeghivkvdagtywyn
    dpytldfmrkdlkeklikaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fkmA (A:)
    pkriavvaptyagglkklganivavnqqvdqskvlkdkfkgvtkigdgdvekvakekpdl
    iivystdkdikkyqkvaptvvvdynkhkyleqqemlgkivgkedkvkawkkdweettakd
    gkeikkaigqdatvslfdefdkklytygdnwgrggevlyqafglkmqpeqqkltakagwa
    evkqeeiekyagdyivstsegkptpgyestnmwknlkatkeghivkvdagtywyndpytl
    dfmrkdlkeklikaak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4fkmB (B:)
    gspkdpkriavvaptyagglkklganivavnqqvdqskvlkdkfkgvtkigdgdvekvak
    ekpdliivystdkdikkyqkvaptvvvdynkhkyleqqemlgkivgkedkvkawkkdwee
    ttakdgkeikkaigqdatvslfdefdkklytygdnwgrggevlyqafglkmqpeqqklta
    kagwaevkqeeiekyagdyivstsegkptpgyestnmwknlkatkeghivkvdagtywyn
    dpytldfmrkdlkeklikaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fkmB (B:)
    dpkriavvaptyagglkklganivavnqqvdqskvlkdkfkgvtkigdgdvekvakekpd
    liivystdkdikkyqkvaptvvvdynkhkyleqqemlgkivgkedkvkawkkdweettak
    dgkeikkaigqdatvslfdefdkklytygdnwgrggevlyqafglkmqpeqqkltakagw
    aevkqeeiekyagdyivstsegkptpgyestnmwknlkatkeghivkvdagtywyndpyt
    ldfmrkdlkeklikaak