PDB entry 4fjv

View 4fjv on RCSB PDB site
Description: Crystal Structure of Human Otubain2 and Ubiquitin Complex
Class: hydrolase
Keywords: Ubiquitin, otubain, NEDD8,cleavage specificity, deubiquitylation, cysteine protease, HYDROLASE
Deposited on 2012-06-12, released 2013-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-25, with a file datestamp of 2015-02-20.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.209
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin thioesterase OTUB2
    Species: Homo sapiens [TaxId:9606]
    Gene: OTUB2, C14orf137, OTB2, OTU2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fjva_
  • Chain 'B':
    Compound: Polyubiquitin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG48 (10-End)
      • expression tag (3-9)
    Domains in SCOPe 2.07: d4fjvb1, d4fjvb2
  • Chain 'C':
    Compound: Ubiquitin thioesterase OTUB2
    Species: Homo sapiens [TaxId:9606]
    Gene: OTUB2, C14orf137, OTB2, OTU2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fjvc_
  • Chain 'D':
    Compound: Polyubiquitin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG48 (10-End)
      • expression tag (3-9)
    Domains in SCOPe 2.07: d4fjvd1, d4fjvd2
  • Heterogens: GOL, NEH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fjvA (A:)
    gshmsetsfnlisekcdilsilrdhpenriyrrkieelskrftairktkgdgncfyralg
    ysylesllgksreifkfkervlqtpndllaagfeehkfrnffnafysvvelvekdgsvss
    llkvfndqsasdhivqflrlltsafirnradffrhfideemdikdfcthevepmatecdh
    iqitalsqalsialqveyvdemdtalnhhvfpeaatpsvyllyktshynilyaadkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fjvA (A:)
    setsfnlisekcdilsilrdhpenriyrrkieelskrftairktkgdgncfyralgysyl
    esllgksreifkfkervlqtpndllaagfeehkfrnffnafysvvelvekdgsvssllkv
    fndqsasdhivqflrlltsafirnradffrhfideemdikdfcthevepmatecdhiqit
    alsqalsialqveyvdemdtalnhhvfpeaatpsvyllyktshynilyaad
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4fjvB (B:)
    ypydvpdyahmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkql
    edgrtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fjvB (B:)
    dvpdyahmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledg
    rtlsdyniqkestlhlvlrlrg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4fjvC (C:)
    gshmsetsfnlisekcdilsilrdhpenriyrrkieelskrftairktkgdgncfyralg
    ysylesllgksreifkfkervlqtpndllaagfeehkfrnffnafysvvelvekdgsvss
    llkvfndqsasdhivqflrlltsafirnradffrhfideemdikdfcthevepmatecdh
    iqitalsqalsialqveyvdemdtalnhhvfpeaatpsvyllyktshynilyaadkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fjvC (C:)
    etsfnlisekcdilsilrdhpenriyrrkieelskrftairktkgdgncfyralgysyle
    sllgksreifkfkervlqtpndllaagfeehkfrnffnafysvvelvekdgsvssllkvf
    ndqsasdhivqflrlltsafirnradffrhfideemdikdfcthevepmatecdhiqita
    lsqalsialqveyvdemdtalnhhvfpeaatpsvyllyktshynilyaad
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4fjvD (D:)
    ypydvpdyahmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkql
    edgrtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fjvD (D:)
    dvpdyahmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledg
    rtlsdyniqkestlhlvlrlrg