PDB entry 4fjq

View 4fjq on RCSB PDB site
Description: Crystal Structure of an alpha-Bisabolol synthase
Class: lyase
Keywords: sesquiterpene synthase, LYASE
Deposited on 2012-06-12, released 2013-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Amorpha-4,11-diene synthase
    Species: Artemisia annua [TaxId:35608]
    Gene: AaBOS, AMS1, KCS12
    Database cross-references and differences (RAF-indexed):
    • PDB 4FJQ (Start-562)
    Domains in SCOPe 2.07: d4fjqa1, d4fjqa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fjqA (A:)
    gshmasmtggqqmgrgsmslteekpirpianfspsiwgdqflivdnqveqgveqivkdlk
    kevrqllkealdipmkhanllklvdeiqrlgisylfeqeidhalqhiyetygdnwsgdrs
    slwfrlmrkqgyfvtcdvfnnhkdesgvfkqslknhvegllelyeatsmrvpgeiileda
    lvftqshlsiiakdtlsinpalsteiqralkkplwkrlprieavqyipfyeqqdshnktl
    iklaklefnllqslhreelsqlskwwkafdvknnapysrdrivecyfwalasrfepqysr
    ariflakvialvtliddiydaygtyeelkifteaierwsitcldmipeymkpiyklfmdt
    ytemeeilakegktnifncgkefvkdfvrvlmveaqwlneghiptteeldsiavnlggan
    lltttcylgmsdivtkeafewavseppllrykgilgrrlndlaghkeeqerkhvsssves
    ymkeynvseeyaknllykqvedlwkdinreylitktiprpllvavinlvhfldvlyaekd
    nftrmgeeyknlvksllvypmsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fjqA (A:)
    psiwgdqflivdnqveqgveqivkdlkkevrqllkealdipmkhanllklvdeiqrlgis
    ylfeqeidhalqhiyetygdnwsgdrsslwfrlmrkqgyfvtcdvfnnhkdesgvfkqsl
    knhvegllelyeatsmrvpgeiiledalvftqshlsiiakdtlsinpalsteiqralkkp
    lwkrlprieavqyipfyeqqdshnktliklaklefnllqslhreelsqlskwwkafdvkn
    napysrdrivecyfwalasrfepqysrariflakvialvtliddiydaygtyeelkifte
    aierwsitcldmipeymkpiyklfmdtytemeeilakegktnifncgkefvkdfvrvlmv
    eaqwlneghiptteeldsiavnlgganlltttcylgmsdivtkeafewavseppllrykg
    ilgrrlndlaghsssvesymkeynvseeyaknllykqvedlwkdinreylitktiprpll
    vavinlvhfldvlyaekdnftrmgeeyknlvksllvypmsi