PDB entry 4fil

View 4fil on RCSB PDB site
Description: Structure of FhuD2 from Staphylococcus Aureus with Bound Ferrioxamine B
Class: metal binding protein
Keywords: Class III Solute Binding Protein, primary binding site for iron-hydroxamate siderophores, FhuCBG, extracellular, METAL BINDING PROTEIN
Deposited on 2012-06-08, released 2013-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-06-04, with a file datestamp of 2014-05-30.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.201
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferric hydroxamate receptor 2
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: fhud2, SAV2284
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7BGA5 (Start-260)
      • engineered mutation (75-76)
      • engineered mutation (79)
    Domains in SCOPe 2.07: d4fila_
  • Chain 'B':
    Compound: Ferric hydroxamate receptor 2
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: fhud2, SAV2284
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7BGA5 (Start-260)
      • engineered mutation (75-76)
      • engineered mutation (79)
    Domains in SCOPe 2.07: d4filb_
  • Chain 'C':
    Compound: Ferric hydroxamate receptor 2
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: fhud2, SAV2284
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7BGA5 (Start-260)
      • engineered mutation (75-76)
      • engineered mutation (79)
    Domains in SCOPe 2.07: d4filc_
  • Chain 'D':
    Compound: Ferric hydroxamate receptor 2
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: fhud2, SAV2284
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7BGA5 (Start-260)
      • engineered mutation (75-76)
      • engineered mutation (79)
    Domains in SCOPe 2.07: d4fild_
  • Heterogens: 0UE, ZN, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4filA (A:)
    gspkdpkriavvaptyagglkklganivavnqqvdqskvlkdkfkgvtkigdgdvekvak
    ekpdliivystdkdiaayqavaptvvvdynkhkyleqqemlgkivgkedkvkawkkdwee
    ttakdgkeikkaigqdatvslfdefdkklytygdnwgrggevlyqafglkmqpeqqklta
    kagwaevkqeeiekyagdyivstsegkptpgyestnmwknlkatkeghivkvdagtywyn
    dpytldfmrkdlkeklikaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >4filA (A:)
    pkriavvaptyagglkklganivavnqqvdqskvlkdkfkgvtkigdgdvekvakekpdl
    iivystdkdiaayqavaptvvvdynkhkyleqqemlgkivgkedkvkawkkdweettakd
    gkeikkaigqdatvslfdefdkklytygdnwgrggevlyqafglkmqpeqqkltakagwa
    evkqeeiekyagdyivstsegkptpgyestnmwknlkatkeghivkvdagtywyndpytl
    dfmrkdlkeklikaak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4filB (B:)
    gspkdpkriavvaptyagglkklganivavnqqvdqskvlkdkfkgvtkigdgdvekvak
    ekpdliivystdkdiaayqavaptvvvdynkhkyleqqemlgkivgkedkvkawkkdwee
    ttakdgkeikkaigqdatvslfdefdkklytygdnwgrggevlyqafglkmqpeqqklta
    kagwaevkqeeiekyagdyivstsegkptpgyestnmwknlkatkeghivkvdagtywyn
    dpytldfmrkdlkeklikaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >4filB (B:)
    pkriavvaptyagglkklganivavnqqvdqskvlkdkfkgvtkigdgdvekvakekpdl
    iivystdkdiaayqavaptvvvdynkhkyleqqemlgkivgkedkvkawkkdweettakd
    gkeikkaigqdatvslfdefdkklytygdnwgrggevlyqafglkmqpeqqkltakagwa
    evkqeeiekyagdyivstsegkptpgyestnmwknlkatkeghivkvdagtywyndpytl
    dfmrkdlkeklikaak
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4filC (C:)
    gspkdpkriavvaptyagglkklganivavnqqvdqskvlkdkfkgvtkigdgdvekvak
    ekpdliivystdkdiaayqavaptvvvdynkhkyleqqemlgkivgkedkvkawkkdwee
    ttakdgkeikkaigqdatvslfdefdkklytygdnwgrggevlyqafglkmqpeqqklta
    kagwaevkqeeiekyagdyivstsegkptpgyestnmwknlkatkeghivkvdagtywyn
    dpytldfmrkdlkeklikaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >4filC (C:)
    pkriavvaptyagglkklganivavnqqvdqskvlkdkfkgvtkigdgdvekvakekpdl
    iivystdkdiaayqavaptvvvdynkhkyleqqemlgkivgkedkvkawkkdweettakd
    gkeikkaigqdatvslfdefdkklytygdnwgrggevlyqafglkmqpeqqkltakagwa
    evkqeeiekyagdyivstsegkptpgyestnmwknlkatkeghivkvdagtywyndpytl
    dfmrkdlkeklikaak
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4filD (D:)
    gspkdpkriavvaptyagglkklganivavnqqvdqskvlkdkfkgvtkigdgdvekvak
    ekpdliivystdkdiaayqavaptvvvdynkhkyleqqemlgkivgkedkvkawkkdwee
    ttakdgkeikkaigqdatvslfdefdkklytygdnwgrggevlyqafglkmqpeqqklta
    kagwaevkqeeiekyagdyivstsegkptpgyestnmwknlkatkeghivkvdagtywyn
    dpytldfmrkdlkeklikaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >4filD (D:)
    pkriavvaptyagglkklganivavnqqvdqskvlkdkfkgvtkigdgdvekvakekpdl
    iivystdkdiaayqavaptvvvdynkhkyleqqemlgkivgkedkvkawkkdweettakd
    gkeikkaigqdatvslfdefdkklytygdnwgrggevlyqafglkmqpeqqkltakagwa
    evkqeeiekyagdyivstsegkptpgyestnmwknlkatkeghivkvdagtywyndpytl
    dfmrkdlkeklikaak