PDB entry 4fi4

View 4fi4 on RCSB PDB site
Description: Crystal structure of mannonate dehydratase PRK15072 (TARGET EFI-502214) from Caulobacter sp. K31
Class: isomerase
Keywords: DEHYDRATASE, MAGNESIUM BINDING, ENZYME FUNCTION INITIATIVE, ENOLASE, MANNONATE DEHYDRATASE, Structural Genomics, ISOMERASE
Deposited on 2012-06-07, released 2012-06-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-06-27, with a file datestamp of 2012-06-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.151
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Caulobacter sp. [TaxId:366602]
    Gene: Caul_1427
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0T0B1 (22-424)
      • expression tag (18-21)
    Domains in SCOPe 2.06: d4fi4a1, d4fi4a2, d4fi4a3
  • Chain 'B':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Caulobacter sp. [TaxId:366602]
    Gene: Caul_1427
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4fi4b1, d4fi4b2
  • Chain 'C':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Caulobacter sp. [TaxId:366602]
    Gene: Caul_1427
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4fi4c1, d4fi4c2
  • Heterogens: MG, GOL, CL, UNL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fi4A (A:)
    mhhhhhhssgvdlgtenlyfqsmlkiidakvivtcpgrnfvtlkittsdgvtgvgdatln
    grelavvsylrdhmipcligrdahriedvwqffyrgsywrggpvamtalaavdmalwdik
    aklagmplyqllggacregvmvyghangetiedtiaearkyqalgykairlqsgvpglps
    tygvsgdkmfyepadgnlptenvwstskylkhapklfeaarealgddvhllhdvhhrltp
    ieagrlgkdlepyrlfwledavpaenqagfrlirqhtttplavgeifshvwdckqlieeq
    lidylratvlhaggitnlrkiaafadlhhvrtgchgatdlspitmaaalhfdlsvsnfgl
    qeymrhtpetdavfphaysykdgmlhpgeapglgvdidealagqypykraylpvnrledg
    tmynw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fi4A (A:)
    yfqsmlkiidakvivtcpgrnfvtlkittsdgvtgvgdatlngrelavvsylrdhmipcl
    igrdahriedvwqffyrgsywrggpvamtalaavdmalwdikaklagmplyqllggacre
    gvmvyghangetiedtiaearkyqalgykairlqsgvpglpstygvsgdkmfyepadgnl
    ptenvwstskylkhapklfeaarealgddvhllhdvhhrltpieagrlgkdlepyrlfwl
    edavpaenqagfrlirqhtttplavgeifshvwdckqlieeqlidylratvlhaggitnl
    rkiaafadlhhvrtgchgatdlspitmaaalhfdlsvsnfglqeymrhtpetdavfphay
    sykdgmlhpgeapglgvdidealagqypykraylpvnrledgtmynw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4fi4B (B:)
    mhhhhhhssgvdlgtenlyfqsmlkiidakvivtcpgrnfvtlkittsdgvtgvgdatln
    grelavvsylrdhmipcligrdahriedvwqffyrgsywrggpvamtalaavdmalwdik
    aklagmplyqllggacregvmvyghangetiedtiaearkyqalgykairlqsgvpglps
    tygvsgdkmfyepadgnlptenvwstskylkhapklfeaarealgddvhllhdvhhrltp
    ieagrlgkdlepyrlfwledavpaenqagfrlirqhtttplavgeifshvwdckqlieeq
    lidylratvlhaggitnlrkiaafadlhhvrtgchgatdlspitmaaalhfdlsvsnfgl
    qeymrhtpetdavfphaysykdgmlhpgeapglgvdidealagqypykraylpvnrledg
    tmynw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fi4B (B:)
    mlkiidakvivtcpgrnfvtlkittsdgvtgvgdatlngrelavvsylrdhmipcligrd
    ahriedvwqffyrgsywrggpvamtalaavdmalwdikaklagmplyqllggacregvmv
    yghangetiedtiaearkyqalgykairlqsgvpglpstygvsgdkmfyepadgnlpten
    vwstskylkhapklfeaarealgddvhllhdvhhrltpieagrlgkdlepyrlfwledav
    paenqagfrlirqhtttplavgeifshvwdckqlieeqlidylratvlhaggitnlrkia
    afadlhhvrtgchgatdlspitmaaalhfdlsvsnfglqeymrhtpetdavfphaysykd
    gmlhpgeapglgvdidealagqypykraylpvnrledgtmynw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4fi4C (C:)
    mhhhhhhssgvdlgtenlyfqsmlkiidakvivtcpgrnfvtlkittsdgvtgvgdatln
    grelavvsylrdhmipcligrdahriedvwqffyrgsywrggpvamtalaavdmalwdik
    aklagmplyqllggacregvmvyghangetiedtiaearkyqalgykairlqsgvpglps
    tygvsgdkmfyepadgnlptenvwstskylkhapklfeaarealgddvhllhdvhhrltp
    ieagrlgkdlepyrlfwledavpaenqagfrlirqhtttplavgeifshvwdckqlieeq
    lidylratvlhaggitnlrkiaafadlhhvrtgchgatdlspitmaaalhfdlsvsnfgl
    qeymrhtpetdavfphaysykdgmlhpgeapglgvdidealagqypykraylpvnrledg
    tmynw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fi4C (C:)
    mlkiidakvivtcpgrnfvtlkittsdgvtgvgdatlngrelavvsylrdhmipcligrd
    ahriedvwqffyrgsywrggpvamtalaavdmalwdikaklagmplyqllggacregvmv
    yghangetiedtiaearkyqalgykairlqsgvpglpstygvsgdkmfyepadgnlpten
    vwstskylkhapklfeaarealgddvhllhdvhhrltpieagrlgkdlepyrlfwledav
    paenqagfrlirqhtttplavgeifshvwdckqlieeqlidylratvlhaggitnlrkia
    afadlhhvrtgchgatdlspitmaaalhfdlsvsnfglqeymrhtpetdavfphaysykd
    gmlhpgeapglgvdidealagqypykraylpvnrledgtmynw