PDB entry 4ffk

View 4ffk on RCSB PDB site
Description: X-ray structure of iron superoxide dismutase from Acidilobus saccharovorans
Class: oxidoreductase
Keywords: oxidoreductase, superoxide acceptor
Deposited on 2012-06-01, released 2012-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Acidilobus saccharovorans [TaxId:666510]
    Gene: ASAC_0498
    Database cross-references and differences (RAF-indexed):
    • Uniprot D9Q0R7 (13-222)
      • expression tag (11-12)
    Domains in SCOPe 2.07: d4ffka1, d4ffka2, d4ffka3
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ffkA (A:)
    mrgshhhhhhgsvvslkryelpplpynydalepiisaetlryhhdkhhlgyvnganaald
    klekylngqltdidvravsrdfefnygghilhtlywlnmapkgkgggtpggaigdainkf
    fgsfdkfkklfgdaaknvegvgwailaydpvtgdlrilqvekhnnvvttnlipllavdvf
    ehayyidyrndrakyvdswwdlinwddvearyqkalntpklil
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ffkA (A:)
    svvslkryelpplpynydalepiisaetlryhhdkhhlgyvnganaaldklekylngqlt
    didvravsrdfefnygghilhtlywlnmapkgkgggtpggaigdainkffgsfdkfkklf
    gdaaknvegvgwailaydpvtgdlrilqvekhnnvvttnlipllavdvfehayyidyrnd
    rakyvdswwdlinwddvearyqkalntpklil