PDB entry 4fee

View 4fee on RCSB PDB site
Description: High-resolution structure of pyruvate oxidase in complex with reaction intermediate 2-hydroxyethyl-thiamin diphosphate carbanion-enamine, crystal B
Class: oxidoreductase
Keywords: Carbanion, structure activity relationship, Oxidation-Reduction, Umpolung, Thiamine diphosphate, reaction intermediate, OXIDOREDUCTASE
Deposited on 2012-05-30, released 2012-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-07-25, with a file datestamp of 2012-07-20.
Experiment type: XRAY
Resolution: 1.13 Å
R-factor: 0.122
AEROSPACI score: 0.93 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyruvate oxidase
    Species: Lactobacillus plantarum [TaxId:644042]
    Gene: pox5, JDM1_2870
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4feea1, d4feea2, d4feea3
  • Chain 'B':
    Compound: Pyruvate oxidase
    Species: Lactobacillus plantarum [TaxId:644042]
    Gene: pox5, JDM1_2870
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4feeb1, d4feeb2, d4feeb3
  • Heterogens: FAD, GOL, PYR, PO4, TDM, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4feeA (A:)
    mvmkqtkqtnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrhee
    vgamaaaadakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmnmdt
    fqemnenpiyadvadynvtavnaatlphvideairrayahqgvavvqipvdlpwqqipae
    dwyasansyqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkip
    lmstypakgivadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntr
    yflqididpaklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwrayl
    asledkqegplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfa
    tmgvgipgaiaaklnyperqvfnlagdggasmtmqdlatqvqyhlpvinvvftncqygfi
    kdeqedtnqndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvli
    davitgdrplpaeklrldsamssaadieafkqryeaqdlqplstylkqfglddlqhqigq
    ggf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4feeA (A:)
    tnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrheevgamaaaa
    dakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmnmdtfqemnenp
    iyadvadynvtavnaatlphvideairrayahqgvavvqipvdlpwqqipaedwyasans
    yqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkiplmstypak
    givadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntryflqidid
    paklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwraylasledkqe
    gplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfatmgvgipg
    aiaaklnyperqvfnlagdggasmtmqdlatqvqyhlpvinvvftncqygfikdeqedtn
    qndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvlidavitgdr
    plpaeklrldsamssaadieafkqryeaqdlqplstylkqfglddl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4feeB (B:)
    mvmkqtkqtnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrhee
    vgamaaaadakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmnmdt
    fqemnenpiyadvadynvtavnaatlphvideairrayahqgvavvqipvdlpwqqipae
    dwyasansyqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkip
    lmstypakgivadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntr
    yflqididpaklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwrayl
    asledkqegplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfa
    tmgvgipgaiaaklnyperqvfnlagdggasmtmqdlatqvqyhlpvinvvftncqygfi
    kdeqedtnqndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvli
    davitgdrplpaeklrldsamssaadieafkqryeaqdlqplstylkqfglddlqhqigq
    ggf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4feeB (B:)
    tnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrheevgamaaaa
    dakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmnmdtfqemnenp
    iyadvadynvtavnaatlphvideairrayahqgvavvqipvdlpwqqipaedwyasans
    yqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkiplmstypak
    givadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntryflqidid
    paklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwraylasledkqe
    gplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfatmgvgipg
    aiaaklnyperqvfnlagdggasmtmqdlatqvqyhlpvinvvftncqygfikdeqedtn
    qndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvlidavitgdr
    plpaeklrldsamssaadieafkqryeaqdlqplstylkqfgl