PDB entry 4fdq

View 4fdq on RCSB PDB site
Description: The crystal structures of several mutants of pleurotus eryngii versatile peroxidase
Class: oxidoreductase
Keywords: lignin peroxidase, lignin degradation, aromatic-substrate binding, oxidoreductase
Deposited on 2012-05-29, released 2012-10-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-12-19, with a file datestamp of 2012-12-14.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.154
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: versatile peroxidase vpl2
    Species: Pleurotus eryngii [TaxId:5323]
    Gene: vpl2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O94753 (0-314)
      • engineered mutation (139)
      • engineered mutation (190)
    Domains in SCOPe 2.06: d4fdqa_
  • Heterogens: CA, HEM, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4fdqA (A:)
atcddgrttanaaccilfpilddiqenlfdgaqcgeevheslrltfhdaigfsptlgggg
adgsiiafdtietnfpanagideivsaqkpfvakhnisagdfiqfagavgvsncpggvri
pfflgrpdavaaspdhlvpgpfdsvdsilarmgdagfspvevvwllashsiaaadkvdps
ipgtpfdstpevfdsqffietqlkgrlfpgtadnkgeaqsplqgeirlqsdhllardpqt
acewqsmvnnqpkiqnrfaatmskmallgqdktklidcsdviptppalvgaahlpagfsl
sdveqacaatpfpal