PDB entry 4fd9

View 4fd9 on RCSB PDB site
Description: Crystal structure of the third beta-gamma-crystallin domain of Crybg3 (betagamma-crystallin domain-containing protein 3) from Mus musculus
Class: structural protein
Keywords: Non-lens vertebrate beta-gamma-crystallin, Brain, STRUCTURAL PROTEIN
Deposited on 2012-05-26, released 2013-04-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-04-10, with a file datestamp of 2013-04-05.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.139
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Beta/gamma crystallin domain-containing protein 3
  Species: MUS MUSCULUS [TaxId:10090]
  Gene: Crybg3
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q80W49 (0-91)
  Domains in SCOPe 2.08: d4fd9a_
• Chain 'B':
  Compound: Beta/gamma crystallin domain-containing protein 3
  Species: MUS MUSCULUS [TaxId:10090]
  Gene: Crybg3
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q80W49 (0-91)
  Domains in SCOPe 2.08: d4fd9b_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4fd9A (A:)
  mnlkvilyekphflghtkefsehidsvptflksdkdfhgigsirviggvwvayekehfkg
  qqflleegdfedssacgalsgpimsfrylqan
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4fd9B (B:)
  mnlkvilyekphflghtkefsehidsvptflksdkdfhgigsirviggvwvayekehfkg
  qqflleegdfedssacgalsgpimsfrylqan