PDB entry 4fck

View 4fck on RCSB PDB site
Description: Crystal Structure of the Co2+2-Human Arginase I-AGPA Complex
Class: Hydrolase/Hydrolase inhibitor
Keywords: Arginase Fold, Hydrolase, Hydrolase-Hydrolase inhibitor complex
Deposited on 2012-05-25, released 2012-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.273
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Arginase-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ARG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fcka_
  • Chain 'B':
    Compound: Arginase-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ARG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4fckb_
  • Heterogens: GPA, CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fckA (A:)
    msaksrtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipn
    dspfqivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgv
    iwvdahtdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglr
    dvdpgehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsf
    tpatgtpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavait
    lacfglaregnhkpidylnppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fckA (A:)
    rtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspfq
    ivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvda
    htdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdpg
    ehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpatg
    tpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacfg
    laregnhkpidyln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4fckB (B:)
    msaksrtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipn
    dspfqivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgv
    iwvdahtdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglr
    dvdpgehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsf
    tpatgtpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavait
    lacfglaregnhkpidylnppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fckB (B:)
    rtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspfq
    ivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvda
    htdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdpg
    ehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpatg
    tpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacfg
    laregnhkpidyln