PDB entry 4fbj

View 4fbj on RCSB PDB site
Description: Structure of the Cif:Nedd8 complex - Photorhabdus luminescens Cycle Inhibiting Factor in complex with human Nedd8
Class: cell cycle/protein binding
Keywords: Effector-Host target complex, Glutamine deamidase, Deamidation, BACTERIAL EFFECTOR, CELL CYCLE-PROTEIN BINDING complex
Deposited on 2012-05-23, released 2012-06-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-06-20, with a file datestamp of 2012-06-15.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.168
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Photorhabdus luminescens subsp. laumondii [TaxId:243265]
    Gene: plu2515
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7N439
      • engineered mutation (75)
  • Chain 'B':
    Compound: nedd8
    Species: Homo sapiens [TaxId:9606]
    Gene: NEDD8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4fbjb_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4fbjB (B:)
mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
ilggsvlhlvlalrgggglrqkhhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >4fbjB (B:)
mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
ilggsvlhlvlalr