PDB entry 4fab

View 4fab on RCSB PDB site
Description: three-dimensional structure of a fluorescein-fab complex crystallized in 2-methyl-2,4-pentanediol
Deposited on 1989-04-10, released 1990-07-15
The last revision prior to the SCOP 1.63 freeze date was dated 1990-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.7 Å
R-factor: 0.215
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fabH (H:)
    evkldetggglvqpgrpmklscvasgftfsdywmnwvrqspekglewvaqirnkpynyet
    yysdsvkgrftisrddskssvylqmnnlrvedmgiyyctgsyygmdywgqgtsvtvssak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkie
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fabL (L:)
    dvvmtqtplslpvslgdqasiscrssqslvhsqgntylrwylqkpgqspkvliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec