PDB entry 4fa8

View 4fa8 on RCSB PDB site
Description: Multi-pronged modulation of cytokine signaling
Class: Viral Protein/Cytokine
Keywords: immunoglobulin-like domains, 4-helix bundle fold, Viral Protein-Cytokine complex
Deposited on 2012-05-21, released 2012-08-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-08-29, with a file datestamp of 2012-08-24.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.224
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: secreted protein barf1
    Species: Human herpesvirus 4 [TaxId:10376]
    Gene: BARF1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: secreted protein barf1
    Species: Human herpesvirus 4 [TaxId:10376]
    Gene: BARF1
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: secreted protein barf1
    Species: Human herpesvirus 4 [TaxId:10376]
    Gene: BARF1
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: macrophage colony-stimulating factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Csf1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09603 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.04: d4fa8e_
  • Chain 'F':
    Compound: macrophage colony-stimulating factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Csf1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09603 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.04: d4fa8f_
  • Chain 'G':
    Compound: macrophage colony-stimulating factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Csf1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09603 (2-146)
      • expression tag (0-1)
    Domains in SCOPe 2.04: d4fa8g_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4fa8E (E:)
    dpseycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafllvqdim
    edtmrfrdntpnaiaivqlqelslrlkscftkdyeehdkacvrtfyetplqllekvknvf
    netknlldkdwnifskncnnsfaecss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fa8E (E:)
    dpseycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafllvqdim
    edtmrfrdntpnaiaivqlqelslrlkscftkdyeehdkacvrtfyetplqllekvknvf
    netknlldkdwnifskncnnsfaec
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4fa8F (F:)
    dpseycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafllvqdim
    edtmrfrdntpnaiaivqlqelslrlkscftkdyeehdkacvrtfyetplqllekvknvf
    netknlldkdwnifskncnnsfaecss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fa8F (F:)
    dpseycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafllvqdim
    edtmrfrdntpnaiaivqlqelslrlkscftkdyeehdkacvrtfyetplqllekvknvf
    netknlldkdwnifskncnnsfaecs
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fa8G (G:)
    dpseycshmigsghlqslqrlidsqmetscqitfefvdqeqlkdpvcylkkafllvqdim
    edtmrfrdntpnaiaivqlqelslrlkscftkdyeehdkacvrtfyetplqllekvknvf
    netknlldkdwnifskncnnsfaecss