PDB entry 4f9l

View 4f9l on RCSB PDB site
Description: Crystal Structure of the Human BTN3A1 Ectodomain in Complex with the 20.1 Single Chain Antibody
Class: immune system
Keywords: B7 superfamily, Butyrophilin, CD277, IMMUNE SYSTEM
Deposited on 2012-05-18, released 2012-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 3.14 Å
R-factor: 0.256
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Butyrophilin subfamily 3 member A1
    Species: Homo sapiens [TaxId:9606]
    Gene: BTF5, BTN3A1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Butyrophilin subfamily 3 member A1
    Species: Homo sapiens [TaxId:9606]
    Gene: BTF5, BTN3A1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 20.1 anti-BTN3A1 antibody fragment
    Species: Mus musculus [TaxId:10090]
    Gene: IgG
    Database cross-references and differences (RAF-indexed):
    • PDB 4F9L (0-End)
    Domains in SCOPe 2.07: d4f9lc1, d4f9lc2
  • Chain 'D':
    Compound: 20.1 anti-BTN3A1 antibody fragment
    Species: Mus musculus [TaxId:10090]
    Gene: IgG
    Database cross-references and differences (RAF-indexed):
    • PDB 4F9L (0-End)
    Domains in SCOPe 2.07: d4f9ld1, d4f9ld2
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4f9lC (C:)
    divltqspsslsaslgdtititchasqninlwlswyqqrpgnipklliyrasnlhtgvps
    rfsgsgsatgftltisslqpediatyycqqghsypytfgggtkldikradaggggsgggg
    sggggsggggsqvqlqesgaelvkpgasvklsckasgytftryylywvkqrpgqglewig
    einpnnggtkfnekfkskatltvdkssrttyiqlssltsedsavyycsreddydgtpdam
    dywgqgtavtvssaasgad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f9lC (C:)
    divltqspsslsaslgdtititchasqninlwlswyqqrpgnipklliyrasnlhtgvps
    rfsgsgsatgftltisslqpediatyycqqghsypytfgggtkldikraqvqlqesgael
    vkpgasvklsckasgytftryylywvkqrpgqglewigeinpnnggtkfnekfkskatlt
    vdkssrttyiqlssltsedsavyycsreddydgtpdamdywgqgtavtvssa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4f9lD (D:)
    divltqspsslsaslgdtititchasqninlwlswyqqrpgnipklliyrasnlhtgvps
    rfsgsgsatgftltisslqpediatyycqqghsypytfgggtkldikradaggggsgggg
    sggggsggggsqvqlqesgaelvkpgasvklsckasgytftryylywvkqrpgqglewig
    einpnnggtkfnekfkskatltvdkssrttyiqlssltsedsavyycsreddydgtpdam
    dywgqgtavtvssaasgad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f9lD (D:)
    divltqspsslsaslgdtititchasqninlwlswyqqrpgnipklliyrasnlhtgvps
    rfsgsgsatgftltisslqpediatyycqqghsypytfgggtkldikraqvqlqesgael
    vkpgasvklsckasgytftryylywvkqrpgqglewigeinpnnggtkfnekfkskatlt
    vdkssrttyiqlssltsedsavyycsreddydgtpdamdywgqgtavtvssa