PDB entry 4f8x

View 4f8x on RCSB PDB site
Description: Penicillium canescens endo-1,4-beta-xylanase XylE
Class: hydrolase
Keywords: TIM barrel, Hydrolase
Deposited on 2012-05-18, released 2012-05-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: 0.147
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase
    Species: Penicillium canescens [TaxId:5083]
    Gene: XYLE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4f8xa_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4f8xA (A:)
    didlnklaqrrgkhwfgtaadipgtaettdaaylkvlkqnfgeitpanamkfmyteteqn
    vfnftegeqflevaerfgskvrchnlvwasqvsdfvtsktwtakeltavmknhifktvqh
    fgrrcyswdvvnealngdgtfsssvwydtigeeyfylafkyaqealaqigandvklyynd
    ygienpgtkstavlqlvsnlrkrgiridgvgleshfivgetpsladqlatkqayikanld
    vavteldvrfstvpyytaaaqkqqaedyyvsvascmnagprcigvvvwdfddayswvpsa
    fagqggaclfnntleakpayyavadalegkpcsvc