PDB entry 4f83

View 4f83 on RCSB PDB site
Description: Crystal structure of the receptor binding domain of botulinum neurotoxin mosaic serotype C/D with a tetraethylene glycol molecule bound on the Hcn sub-domain and a sulfate ion at the putative active site
Class: toxin
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Seattle Structural Genomics Center for Infectious Disease, SSGCID, Botulinum neurotoxin, mosaic serotype C/D, TOXIN
Deposited on 2012-05-16, released 2012-06-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-06-12, with a file datestamp of 2013-06-07.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.17
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type C neurotoxin
    Species: Clostridium botulinum [TaxId:1491]
    Gene: bont/C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5DW55 (0-413)
      • expression tag (414-415)
    Domains in SCOPe 2.06: d4f83a1, d4f83a2, d4f83a3
  • Heterogens: PG4, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4f83A (A:)
    sindskilslqnkknalvdtsgynaevrlegdvqvntiytndfklsssgdkiivnlnnni
    lysaiyenssvsfwikiskdltnshneytiinsikqnsgwklcirngniewilqdinrky
    kslifdyseslshtgytnkwffvtitnnimgymklyingelkqseriedldevkldktiv
    fgidenidenqmlwirdfnifskelsnedinivyegqilrnvikdywgnplkfdteyymi
    nynyidryiapknnilvlvqysdisklytknpitiksaanknpysrilngddimfhmlyd
    sreymiirdtdtiyatqggqcskncvyalklqsnlgnygigifsiknivsqnkycsqifs
    sfmkntmlladiykpwrfsfenaytpvavtnyetkllstssfwkfisrdpgwvehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f83A (A:)
    sindskilslqnkknalvdtsgynaevrlegdvqvntiytndfklsssgdkiivnlnnni
    lyyenssvsfwikiskdltnshneytiinsikqnsgwklcirngniewilqdinrkyksl
    ifdyseslshtgytnkwffvtitnnimgymklyingelkqseriedldevkldktivfgi
    denidenqmlwirdfnifskelsnedinivyegqilrnvikdywgnplkfdteyyminyn
    yidryiapknnilvlvqysdisklytknpitiksaanknpysrilngddimfhmlydsre
    ymiirdtdtiyatqggqcskncvyalklqsnlgnygigifsiknivsqnkycsqifssfm
    kntmlladiykpwrfsfenaytpvavtnyetkllstssfwkfisrdpgwvehh