PDB entry 4f7u

View 4f7u on RCSB PDB site
Description: The 6S snRNP assembly intermediate
Class: splicing
Keywords: Assembly Machine, SPLICING
Deposited on 2012-05-16, released 2013-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Small nuclear ribonucleoprotein Sm D1
    Species: Mus musculus [TaxId:10090]
    Gene: SNRPD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4f7ua_
  • Chain 'B':
    Compound: Small nuclear ribonucleoprotein Sm D2
    Species: Mus musculus [TaxId:10090]
    Gene: SNRPD2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4f7ub_
  • Chain 'C':
    Compound: Small nuclear ribonucleoprotein Sm D1
    Species: Mus musculus [TaxId:10090]
    Gene: SNRPD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4f7uc_
  • Chain 'D':
    Compound: Small nuclear ribonucleoprotein Sm D2
    Species: Mus musculus [TaxId:10090]
    Gene: SNRPD2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4f7ud_
  • Chain 'E':
    Compound: Small nuclear ribonucleoprotein E
    Species: Mus musculus [TaxId:10090]
    Gene: SNRPE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4f7ue_
  • Chain 'F':
    Compound: Small nuclear ribonucleoprotein F
    Species: Xenopus laevis [TaxId:8355]
    Gene: SNRPF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4f7uf_
  • Chain 'G':
    Compound: Small nuclear ribonucleoprotein G
    Species: Mus musculus [TaxId:10090]
    Gene: SNRPG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4f7ug_
  • Chain 'H':
    Compound: Small nuclear ribonucleoprotein E
    Species: Mus musculus [TaxId:10090]
    Gene: SNRPE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4f7uh_
  • Chain 'I':
    Compound: Small nuclear ribonucleoprotein F
    Species: Xenopus laevis [TaxId:8355]
    Gene: SNRPF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4f7ui_
  • Chain 'J':
    Compound: Small nuclear ribonucleoprotein G
    Species: Mus musculus [TaxId:10090]
    Gene: SNRPG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4f7uj_
  • Chain 'P':
    Compound: Methylosome subunit pICln
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CG4924, icln
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1ZAW5 (0-End)
      • see remark 999 (5)
    • Uniprot A1ZAW5 (Start-123)
      • engineered mutation (107)
  • Chain 'Q':
    Compound: Methylosome subunit pICln
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CG4924, icln
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1ZAW5 (0-End)
      • see remark 999 (5)
    • Uniprot A1ZAW5 (Start-123)
      • engineered mutation (107)
      • expression tag (124-125)
  • Heterogens: P6G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4f7uA (A:)
    mklvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsi
    rgnniryfilpdslpldtllvdvepkvkskkreavagrgrgrgrgrgrgrgrgrggprr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f7uA (A:)
    mklvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsi
    rgnniryfilpdslpldtllvd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4f7uB (B:)
    msllnkpksemtpeelqkreeeefntgplsvltqsvknntqvlincrnnkkllgrvkafd
    rhcnmvlenvkemwtevpksgkgkkkskpvnkdryiskmflrgdsvivvlrnpliagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f7uB (B:)
    eefntgplsvltqsvknntqvlincrnnkkllgrvkafdrhcnmvlenvkemwtevnkdr
    yiskmflrgdsvivvlrnpl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4f7uC (C:)
    mklvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsi
    rgnniryfilpdslpldtllvdvepkvkskkreavagrgrgrgrgrgrgrgrgrggprr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f7uC (C:)
    klvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsir
    gnniryfilpdslpldtllvd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4f7uD (D:)
    msllnkpksemtpeelqkreeeefntgplsvltqsvknntqvlincrnnkkllgrvkafd
    rhcnmvlenvkemwtevpksgkgkkkskpvnkdryiskmflrgdsvivvlrnpliagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f7uD (D:)
    lqkreeeefntgplsvltqsvknntqvlincrnnkkllgrvkafdrhcnmvlenvkemwt
    evnkdryiskmflrgdsvivvlrnp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4f7uE (E:)
    mayrgqgqkvqkvmvqpinlifrylqnrsriqvwlyeqvnmriegciigfdeymnlvldd
    aeeihsktksrkqlgrimlkgdnitllqsvsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f7uE (E:)
    vmvqpinlifrylqnrsriqvwlyeqvnmriegciigfdeymnlvlddaeeihsktksrk
    qlgrimlkgdnitllqsv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4f7uF (F:)
    mslplnpkpflngltgkpvmvklkwgmeykgylvsvdgymnmqlanteeyidgalsghlg
    evlircnnvlyirgveeeeedgemre
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f7uF (F:)
    plnpkpflngltgkpvmvklkwgmeykgylvsvdgymnmqlanteeyidgalsghlgevl
    ircnnvlyirgve
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4f7uG (G:)
    mskahppelkkfmdkklslklnggrhvqgilrgfdpfmnlvidecvematsgqqnnigmv
    virgnsiimlealerv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f7uG (G:)
    pelkkfmdkklslklnggrhvqgilrgfdpfmnlvidecvematsgqqnnigmvvirgns
    iimleale
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4f7uH (H:)
    mayrgqgqkvqkvmvqpinlifrylqnrsriqvwlyeqvnmriegciigfdeymnlvldd
    aeeihsktksrkqlgrimlkgdnitllqsvsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f7uH (H:)
    mvqpinlifrylqnrsriqvwlyeqvnmriegciigfdeymnlvlddaeeihsktksrkq
    lgrimlkgdnitllqsvs
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4f7uI (I:)
    mslplnpkpflngltgkpvmvklkwgmeykgylvsvdgymnmqlanteeyidgalsghlg
    evlircnnvlyirgveeeeedgemre
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f7uI (I:)
    lplnpkpflngltgkpvmvklkwgmeykgylvsvdgymnmqlanteeyidgalsghlgev
    lircnnvlyirgve
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4f7uJ (J:)
    mskahppelkkfmdkklslklnggrhvqgilrgfdpfmnlvidecvematsgqqnnigmv
    virgnsiimlealerv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f7uJ (J:)
    elkkfmdkklslklnggrhvqgilrgfdpfmnlvidecvematsgqqnnigmvvirgnsi
    imleale
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.