PDB entry 4f7e

View 4f7e on RCSB PDB site
Description: Crystal structure of bovine CD1d with bound C16:0-alpha-galactosyl ceramide
Class: immune system
Keywords: protein-glycolipid complex, MHC-fold, Ig-fold, antigen presentation, TCR, membrane, IMMUNE SYSTEM
Deposited on 2012-05-15, released 2012-11-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.223
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CD1D antigen, d polypeptide
    Species: Bos taurus [TaxId:9913]
    Gene: CD1D
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1L565 (Start-276)
      • expression tag (277)
    Domains in SCOPe 2.06: d4f7ea1, d4f7ea2, d4f7ea3
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Bos taurus [TaxId:9913]
    Gene: B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4f7eb_
  • Heterogens: 0SH, NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4f7eA (A:)
    spapqtpfsfqglqissfanrswtrtdglawlgelqpytwrnesdtirflkpwsrgtfsd
    qqweqlqhtllvyrssftrdiwefveklhveypleiqiatgcellprnisesflraafqg
    rdvlsfqgmswvsapdappfiqevikvlnqnqgtketvhwllhdiwpelvrgvlqtgkse
    lekqvkpeawlssgpspgpgrlllvchvsgfypkpvrvmwmrgeqeepgtrqgdvmpnad
    stwylrvtldvaagevaglscqvkhsslgdqdiilywhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f7eA (A:)
    fsfqglqissfanrswtrtdglawlgelqpytwrnesdtirflkpwsrgtfsdqqweqlq
    htllvyrssftrdiwefveklhveypleiqiatgcellprnisesflraafqgrdvlsfq
    gmswvsapdappfiqevikvlnqnqgtketvhwllhdiwpelvrgvlqtgkselekqvkp
    eawlssgpspgpgrlllvchvsgfypkpvrvmwmrgeqeepgtrqgdvmpnadstwylrv
    tldvaagevaglscqvkhsslgdqdiilywh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4f7eB (B:)
    iqrppkiqvysrhppedgkpnylncyvygfhppqieidllkngekikseqsdlsfskdws
    fyllshaeftpnskdqyscrvkhvtleqprivkwdrdl