PDB entry 4f7c

View 4f7c on RCSB PDB site
Description: Crystal structure of bovine CD1d with bound C12-di-sulfatide
Class: immune system
Keywords: protein-glycolipid complex, MHC-fold, Ig-fold, antigen presentation, TCR, membrane, IMMUNE SYSTEM
Deposited on 2012-05-15, released 2012-11-14
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 2.86 Å
R-factor: 0.225
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CD1D antigen, d polypeptide
    Species: Bos taurus [TaxId:9913]
    Gene: CD1D
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1L565 (Start-276)
      • expression tag (277-278)
    Domains in SCOPe 2.03: d4f7ca1, d4f7ca2
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Bos taurus [TaxId:9913]
    Gene: B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4f7cb_
  • Chain 'C':
    Compound: CD1D antigen, d polypeptide
    Species: Bos taurus [TaxId:9913]
    Gene: CD1D
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1L565 (Start-276)
      • expression tag (277-278)
    Domains in SCOPe 2.03: d4f7cc1, d4f7cc2
  • Chain 'D':
    Compound: Beta-2-microglobulin
    Species: Bos taurus [TaxId:9913]
    Gene: B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4f7cd_
  • Heterogens: 0SG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4f7cA (A:)
    spapqtpfsfqglqissfanrswtrtdglawlgelqpytwrnesdtirflkpwsrgtfsd
    qqweqlqhtllvyrssftrdiwefveklhveypleiqiatgcellprnisesflraafqg
    rdvlsfqgmswvsapdappfiqevikvlnqnqgtketvhwllhdiwpelvrgvlqtgkse
    lekqvkpeawlssgpspgpgrlllvchvsgfypkpvrvmwmrgeqeepgtrqgdvmpnad
    stwylrvtldvaagevaglscqvkhsslgdqdiilywhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f7cA (A:)
    pfsfqglqissfanrswtrtdglawlgelqpytwrnesdtirflkpwsrgtfsdqqweql
    qhtllvyrssftrdiwefveklhveypleiqiatgcellsesflraafqgrdvlsfqgms
    wvsapdappfiqevikvlnqnqgtketvhwllhdiwpelvrgvlqtgkselekqvkpeaw
    lssgpspgpgrlllvchvsgfypkpvrvmwmrgeqeepgtrqgdvmpnadstwylrvtld
    vaagevaglscqvkhsslgdqdiilywhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4f7cB (B:)
    iqrppkiqvysrhppedgkpnylncyvygfhppqieidllkngekikseqsdlsfskdws
    fyllshaeftpnskdqyscrvkhvtleqprivkwdrdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f7cB (B:)
    iqrppkiqvysrhppedgkpnylncyvygfhppqieidllkngekikseqsdlsfskdws
    fyllshaeftpnskdqyscrvkhvtleqprivkwdrd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4f7cC (C:)
    spapqtpfsfqglqissfanrswtrtdglawlgelqpytwrnesdtirflkpwsrgtfsd
    qqweqlqhtllvyrssftrdiwefveklhveypleiqiatgcellprnisesflraafqg
    rdvlsfqgmswvsapdappfiqevikvlnqnqgtketvhwllhdiwpelvrgvlqtgkse
    lekqvkpeawlssgpspgpgrlllvchvsgfypkpvrvmwmrgeqeepgtrqgdvmpnad
    stwylrvtldvaagevaglscqvkhsslgdqdiilywhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f7cC (C:)
    fsfqglqissfanrswtrtdglawlgelqpytwrnesdtirflkpwsrgtfsdqqweqlq
    htllvyrssftrdiwefveklhveypleiqiatgcellsesflraafqgrdvlsfqgmsw
    vsapdappfiqevikvlnqnqgtketvhwllhdiwpelvrgvlqtgkselekqvkpeawl
    ssgpspgpgrlllvchvsgfypkpvrvmwmrgeqeepgtrqgdvmpnadstwylrvtldv
    aglscqvkhsslgdqdiilywhh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4f7cD (D:)
    iqrppkiqvysrhppedgkpnylncyvygfhppqieidllkngekikseqsdlsfskdws
    fyllshaeftpnskdqyscrvkhvtleqprivkwdrdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f7cD (D:)
    iqrppkiqvysrhppedgkpnylncyvygfhppqieidllkngekikseqsdlsfskdws
    fyllshaeftpnskdqyscrvkhvtleqprivkwdrd