PDB entry 4f79

View 4f79 on RCSB PDB site
Description: The crystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate
Class: hydrolase
Keywords: structural genomics, PSI-Biology, protein structure initiative, midwest center for structural genomics, MCSG, HYDROLASE
Deposited on 2012-05-15, released 2012-06-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-06-13, with a file datestamp of 2012-06-08.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: 0.183
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative phospho-beta-glucosidase
    Species: Streptococcus mutans [TaxId:1309]
    Gene: bgl, SMU_1601
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DT00 (3-479)
      • expression tag (2)
      • engineered mutation (377)
    Domains in SCOPe 2.06: d4f79a1, d4f79a2
  • Heterogens: P53, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4f79A (A:)
    snamsklpenflwggavaahqleggwqeggkgisvadvmtagrhgvareitagvlegkyy
    pnheaidfyhhykedvklfaemgfkcfrtsiawtrifpkgdeaepneaglqfyddlfdec
    lkygiepvvtlshfelpyhlvteyggftnrkvidffvhfaevcfrrykdkvkywmtfnei
    nnqanyqedfapftnsgivykegddreaimyqaahyelvasaravkighainpnlnigcm
    vamcpiypatcnpkdilmaqkamqkryyfadvhvhgfypehifkywerkaikvdfterdk
    kdlfegtvdyigfsyymsfvidahrennpyydyletedlvknpyvkasdwdwqidpqglr
    yalnwftdmyhlplfivqngfgaidqveadgmvhddyridylgahikemikavdedgvel
    mgytpwgcidlvsagtgemrkrygfiyvdkddegkgtlkrspklsfnwykeviasngddi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f79A (A:)
    amsklpenflwggavaahqleggwqeggkgisvadvmtagrhgvareitagvlegkyypn
    heaidfyhhykedvklfaemgfkcfrtsiawtrifpkgdeaepneaglqfyddlfdeclk
    ygiepvvtlshfelpyhlvteyggftnrkvidffvhfaevcfrrykdkvkywmtfneinn
    qanyqedfapftnsgivykegddreaimyqaahyelvasaravkighainpnlnigcmva
    mcpiypatcnpkdilmaqkamqkryyfadvhvhgfypehifkywerkaikvdfterdkkd
    lfegtvdyigfsyymsfvidahrennpyydyletedlvknpyvkasdwdwqidpqglrya
    lnwftdmyhlplfivqngfgaidqveadgmvhddyridylgahikemikavdedgvelmg
    ytpwgcidlvsagtgemrkrygfiyvdkddegkgtlkrspklsfnwykeviasngddi