PDB entry 4f6e

View 4f6e on RCSB PDB site
Description: Crystal Structure of the K182R, A183P mutant manganese superoxide dismutase from Sacchromyces cerevisiae
Class: oxidoreductase
Keywords: Mn Superoxide Dismutase, dimer interface, OXIDOREDUCTASE
Deposited on 2012-05-14, released 2013-06-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-06-12, with a file datestamp of 2013-06-07.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.166
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Mn], mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: SOD2, YHR008C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00447 (1-206)
      • expression tag (0)
      • engineered mutation (181-182)
    Domains in SCOPe 2.03: d4f6ea1, d4f6ea2
  • Chain 'B':
    Compound: Superoxide dismutase [Mn], mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: SOD2, YHR008C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00447 (1-End)
      • expression tag (0)
      • engineered mutation (181-182)
    Domains in SCOPe 2.03: d4f6eb1, d4f6eb2
  • Chain 'C':
    Compound: Superoxide dismutase [Mn], mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: SOD2, YHR008C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00447 (1-206)
      • expression tag (0)
      • engineered mutation (181-182)
    Domains in SCOPe 2.03: d4f6ec1, d4f6ec2
  • Chain 'D':
    Compound: Superoxide dismutase [Mn], mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: SOD2, YHR008C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00447 (1-End)
      • expression tag (0)
      • engineered mutation (181-182)
    Domains in SCOPe 2.03: d4f6ed1, d4f6ed2
  • Heterogens: MN, TRS, MLY, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4f6eA (A:)
    kvtlpdlkwdfgalepyisgqinelhytkhhqtyvngfntavdqfqelsdllakepspan
    arkmiaiqqnikfhgggftnhclfwenlapesqgggepptgalakaideqfgsldelikl
    tntklagvqgsgwafivknlsnggkldvvqtynqdtvtgplvplvaidawehayylqyqn
    krpdyfkaiwnvvnwkeasrrfdagki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4f6eB (B:)
    kvtlpdlkwdfgalepyisgqinelhytkhhqtyvngfntavdqfqelsdllakepspan
    arkmiaiqqnikfhgggftnhclfwenlapesqgggepptgalakaideqfgsldelikl
    tntklagvqgsgwafivknlsnggkldvvqtynqdtvtgplvplvaidawehayylqyqn
    krpdyfkaiwnvvnwkeasrrfdagki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f6eB (B:)
    kvtlpdlkwdfgalepyisgqinelhytkhhqtyvngfntavdqfqelsdllakepspan
    arkmiaiqqnikfhgggftnhclfwenlapesqgggepptgalakaideqfgsldelikl
    tntklagvqgsgwafivknlsnggkldvvqtynqdtvtgplvplvaidawehayylqyqn
    krpdyfkaiwnvvnwkeasrrfdag
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4f6eC (C:)
    kvtlpdlkwdfgalepyisgqinelhytkhhqtyvngfntavdqfqelsdllakepspan
    arkmiaiqqnikfhgggftnhclfwenlapesqgggepptgalakaideqfgsldelikl
    tntklagvqgsgwafivknlsnggkldvvqtynqdtvtgplvplvaidawehayylqyqn
    krpdyfkaiwnvvnwkeasrrfdagki
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4f6eD (D:)
    kvtlpdlkwdfgalepyisgqinelhytkhhqtyvngfntavdqfqelsdllakepspan
    arkmiaiqqnikfhgggftnhclfwenlapesqgggepptgalakaideqfgsldelikl
    tntklagvqgsgwafivknlsnggkldvvqtynqdtvtgplvplvaidawehayylqyqn
    krpdyfkaiwnvvnwkeasrrfdagki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f6eD (D:)
    kvtlpdlkwdfgalepyisgqinelhytkhhqtyvngfntavdqfqelsdllakepspan
    arkmiaiqqnikfhgggftnhclfwenlapesqgggepptgalakaideqfgsldelikl
    tntklagvqgsgwafivknlsnggkldvvqtynqdtvtgplvplvaidawehayylqyqn
    krpdyfkaiwnvvnwkeasrrfdag