PDB entry 4f66

View 4f66 on RCSB PDB site
Description: The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate.
Class: hydrolase
Keywords: structural genomics, PSI-Biology, protein structure initiative, midwest center for structural genomics, MCSG, HYDROLASE
Deposited on 2012-05-14, released 2012-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative phospho-beta-glucosidase
    Species: Streptococcus mutans [TaxId:1309]
    Gene: bgl, SMU_1601
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DT00 (3-479)
      • expression tag (2)
    Domains in SCOPe 2.07: d4f66a1, d4f66a2
  • Chain 'B':
    Compound: Putative phospho-beta-glucosidase
    Species: Streptococcus mutans [TaxId:1309]
    Gene: bgl, SMU_1601
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DT00 (3-479)
      • expression tag (2)
    Domains in SCOPe 2.07: d4f66b1, d4f66b2
  • Heterogens: BG6, EDO, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4f66A (A:)
    snamsklpenflwggavaahqleggwqeggkgisvadvmtagrhgvareitagvlegkyy
    pnheaidfyhhykedvklfaemgfkcfrtsiawtrifpkgdeaepneaglqfyddlfdec
    lkygiepvvtlshfelpyhlvteyggftnrkvidffvhfaevcfrrykdkvkywmtfnei
    nnqanyqedfapftnsgivykegddreaimyqaahyelvasaravkighainpnlnigcm
    vamcpiypatcnpkdilmaqkamqkryyfadvhvhgfypehifkywerkaikvdfterdk
    kdlfegtvdyigfsyymsfvidahrennpyydyletedlvknpyvkasdwdwqidpqglr
    yalnwftdmyhlplfivengfgaidqveadgmvhddyridylgahikemikavdedgvel
    mgytpwgcidlvsagtgemrkrygfiyvdkddegkgtlkrspklsfnwykeviasngddi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f66A (A:)
    amsklpenflwggavaahqleggwqeggkgisvadvmtagrhgvareitagvlegkyypn
    heaidfyhhykedvklfaemgfkcfrtsiawtrifpkgdeaepneaglqfyddlfdeclk
    ygiepvvtlshfelpyhlvteyggftnrkvidffvhfaevcfrrykdkvkywmtfneinn
    qanyqedfapftnsgivykegddreaimyqaahyelvasaravkighainpnlnigcmva
    mcpiypatcnpkdilmaqkamqkryyfadvhvhgfypehifkywerkaikvdfterdkkd
    lfegtvdyigfsyymsfvidahrennpyydyletedlvknpyvkasdwdwqidpqglrya
    lnwftdmyhlplfivengfgaidqveadgmvhddyridylgahikemikavdedgvelmg
    ytpwgcidlvsagtgemrkrygfiyvdkddegkgtlkrspklsfnwykeviasngddi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4f66B (B:)
    snamsklpenflwggavaahqleggwqeggkgisvadvmtagrhgvareitagvlegkyy
    pnheaidfyhhykedvklfaemgfkcfrtsiawtrifpkgdeaepneaglqfyddlfdec
    lkygiepvvtlshfelpyhlvteyggftnrkvidffvhfaevcfrrykdkvkywmtfnei
    nnqanyqedfapftnsgivykegddreaimyqaahyelvasaravkighainpnlnigcm
    vamcpiypatcnpkdilmaqkamqkryyfadvhvhgfypehifkywerkaikvdfterdk
    kdlfegtvdyigfsyymsfvidahrennpyydyletedlvknpyvkasdwdwqidpqglr
    yalnwftdmyhlplfivengfgaidqveadgmvhddyridylgahikemikavdedgvel
    mgytpwgcidlvsagtgemrkrygfiyvdkddegkgtlkrspklsfnwykeviasngddi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f66B (B:)
    amsklpenflwggavaahqleggwqeggkgisvadvmtagrhgvareitagvlegkyypn
    heaidfyhhykedvklfaemgfkcfrtsiawtrifpkgdeaepneaglqfyddlfdeclk
    ygiepvvtlshfelpyhlvteyggftnrkvidffvhfaevcfrrykdkvkywmtfneinn
    qanyqedfapftnsgivykegddreaimyqaahyelvasaravkighainpnlnigcmva
    mcpiypatcnpkdilmaqkamqkryyfadvhvhgfypehifkywerkaikvdfterdkkd
    lfegtvdyigfsyymsfvidahrennpyydyletedlvknpyvkasdwdwqidpqglrya
    lnwftdmyhlplfivengfgaidqveadgmvhddyridylgahikemikavdedgvelmg
    ytpwgcidlvsagtgemrkrygfiyvdkddegkgtlkrspklsfnwykeviasngddi