PDB entry 4f65

View 4f65 on RCSB PDB site
Description: Crystal structure of Human Fibroblast Growth Factor Receptor 1 Kinase domain in complex with compound 8
Class: transferase/transferase inhibitor
Keywords: kinase, ATP binding, phosphorylation, trans-membrane, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2012-05-14, released 2012-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-27, with a file datestamp of 2012-06-22.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: 0.204
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1, BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362 (Start-308)
      • engineered mutation (31)
    Domains in SCOPe 2.07: d4f65a_
  • Chain 'B':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1, BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362
      • engineered mutation (31)
    Domains in SCOPe 2.07: d4f65b_
  • Heterogens: SO4, EDO, 0S9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4f65A (A:)
    gagvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkml
    ksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqar
    rppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednv
    mkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftl
    ggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldr
    ivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f65A (A:)
    elpedprwelprdrlvlgkplgegafgqvvlaeaigldkpnrvtkvavkmlksdatekdl
    sdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrpppeeqls
    skdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfyykkttngrlpvkw
    mapealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkpsnct
    nelymmmrdcwhavpsqrptfkqlvedldrivaltsnqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4f65B (B:)
    gagvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkml
    ksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqar
    rppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednv
    mkiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftl
    ggspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldr
    ivaltsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f65B (B:)
    vseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldpnrvtkvavkmlksdate
    kdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrpqlss
    kdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfhidyykkttngrlpv
    kwmapealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkpsn
    ctnelymmmrdcwhavpsqrptfkqlvedldrivaltsn