PDB entry 4f62

View 4f62 on RCSB PDB site
Description: Crystal structure of a putative farnesyl-diphosphate synthase from Marinomonas sp. MED121 (Target EFI-501980)
Class: transferase
Keywords: Enzyme Function Initiative, Structural Genomics, TRANSFERASE
Deposited on 2012-05-14, released 2012-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geranyltranstransferase
    Species: Marinomonas sp. MED121 [TaxId:314277]
    Gene: MED121_18165
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3YCB7 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d4f62a1, d4f62a2
  • Chain 'B':
    Compound: Geranyltranstransferase
    Species: Marinomonas sp. MED121 [TaxId:314277]
    Gene: MED121_18165
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3YCB7 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d4f62b1, d4f62b2
  • Heterogens: SO4, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4f62A (A:)
    mvmnlkqfstytqsrvdqyleqqlsdyapanqlhnamryslfnggkrirpmltyasaqlv
    gdissltdasaaalesihayslihddlpamdndelrrgkptchiqfdeatailagdalqt
    fafellsnptsaqpelaikliqelvvasgrngmitgqmidlssenknislaeleqmhvhk
    tgalikasvrmgalstgqvkpeqlakldayahaiglafqvqddiidltsdtetlgktqfs
    daeankatypkllgldgakalvvrlheqaiaqisefgdksqpltdlanyiidrnhaenly
    fqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f62A (A:)
    vmnlkqfstytqsrvdqyleqqlsdyapanqlhnamryslfggkrirpmltyasaqlvgd
    issltdasaaalesihayslihddlpamdnptchiqfdeatailagdalqtfafellsnp
    tsaqpelaikliqelvvasgrngmitgqmidlssenknislaeleqmhvhktgalikasv
    rmgalstgqvkpeqlakldayahaiglafqvqddiidltnkatypkllgldgakalvvrl
    heqaiaqisefgdksqpltdlanyiid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4f62B (B:)
    mvmnlkqfstytqsrvdqyleqqlsdyapanqlhnamryslfnggkrirpmltyasaqlv
    gdissltdasaaalesihayslihddlpamdndelrrgkptchiqfdeatailagdalqt
    fafellsnptsaqpelaikliqelvvasgrngmitgqmidlssenknislaeleqmhvhk
    tgalikasvrmgalstgqvkpeqlakldayahaiglafqvqddiidltsdtetlgktqfs
    daeankatypkllgldgakalvvrlheqaiaqisefgdksqpltdlanyiidrnhaenly
    fqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f62B (B:)
    vmnlkqfstytqsrvdqyleqqlsdyapanqlhnamryslfggkrirpmltyasaqlvgd
    issltdasaaalesihayslihddlpamfdeatailagdalqtfafellsnptsaqpela
    ikliqelvvasgrngmitgqmidlssenislaeleqmhvhktgalikasvrmgalstgqv
    kpeqlakldayahaiglafqvqddiidlkatypkllgldgakalvvrlheqaiaqisefg
    dksqpltdlanyiid