PDB entry 4f5v

View 4f5v on RCSB PDB site
Description: Crystal Structure of Leporine Serum Albumin
Class: transport protein
Keywords: Leporine Serum Albumin, helical structure, TRANSPORT PROTEIN
Deposited on 2012-05-13, released 2012-10-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-10-03, with a file datestamp of 2012-09-28.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: 0.196
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serum albumin
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4f5va1, d4f5va2, d4f5va3
  • Heterogens: PG4, PGE, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4f5vA (A:)
    eahkseiahrfndvgeehfiglvlitfsqylqkcpyeehaklvkevtdlakacvadesaa
    ncdkslhdifgdkicalpslrdtygdvadccekkepernecflhhkddkpdlppfarpea
    dvlckafhddekaffghylyevarrhpyfyapellyyaqkykailtecceaadkgacltp
    kldalkekalisaaqerlrcasiqkfgdraykawalvrlsqrfpkadftdiskivtdltk
    vhkecchgdllecaddradlakymcehqetisshlkeccdkpilekahciyglhndetpa
    glpavaeefvedkdvcknyeeakdlflgkflyeysrrhpdysvvlllrlgkayeatlkkc
    catddphacyakvldefqplvdepknlvkqncelyeqlgdynfqnallvrytkkvpqvst
    ptlveisrslgkvgskcckhpeaerlpcvedylsvvlnrlcvlhektpvsekvtkccses
    lvdrrpcfsalgpdetyvpkefnaetftfhadictlpeterkikkqtalvelvkhkphat
    ndqlktvvgeftalldkccsaedkeacfavegpklvesskatlg