PDB entry 4f5b

View 4f5b on RCSB PDB site
Description: Triple mutant Src SH2 domain bound to phosphotyrosine
Class: protein binding
Keywords: SH2 domain, Cell signalling, phosphotyrosine, PROTEIN BINDING
Deposited on 2012-05-12, released 2012-10-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-10-03, with a file datestamp of 2012-09-28.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: 0.2
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Homo sapiens [TaxId:9606]
    Gene: SRC, SRC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12931 (3-End)
      • engineered mutation (42)
      • engineered mutation (47)
      • engineered mutation (65)
    Domains in SCOPe 2.06: d4f5ba_
  • Heterogens: PTR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4f5bA (A:)
    gamdsiqaeewyfgkitrreserlllnaenprgtflvresetvkgayalsvsdfdnakgl
    nvkhylirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcptsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f5bA (A:)
    dsiqaeewyfgkitrreserlllnaenprgtflvresetvkgayalsvsdfdnakglnvk
    hylirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcpts