PDB entry 4f52

View 4f52 on RCSB PDB site
Description: Structure of a Glomulin-RBX1-CUL1 complex
Class: Cell Cycle/Ligase/Signaling Protein
Keywords: Cullin-RING E3 Ligase, Inhibitor, Cell Cycle-Ligase-Signaling Protein complex
Deposited on 2012-05-11, released 2012-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-09-19, with a file datestamp of 2012-09-14.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.222
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cullin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: CUL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13616
      • engineered mutation (12)
      • engineered mutation (42-43)
      • engineered mutation (46)
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase RBX1
    Species: Homo sapiens [TaxId:9606]
    Gene: RBX1, RNF75, ROC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4f52b_
  • Chain 'C':
    Compound: Cullin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: CUL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13616
      • engineered mutation (12)
      • engineered mutation (42-43)
      • engineered mutation (46)
  • Chain 'D':
    Compound: E3 ubiquitin-protein ligase RBX1
    Species: Homo sapiens [TaxId:9606]
    Gene: RBX1, RNF75, ROC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4f52d_
  • Chain 'E':
    Compound: Glomulin
    Species: Homo sapiens [TaxId:9606]
    Gene: GLMN, FAP48, FAP68, VMGLOM
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Glomulin
    Species: Homo sapiens [TaxId:9606]
    Gene: GLMN, FAP48, FAP68, VMGLOM
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4f52B (B:)
    gsmdvdtpsgtnsgagkkrfevkkwnavalwawdivvdncaicrnhimdlciecqanqas
    atseectvawgvcnhafhfhcisrwlktrqvcpldnrewefqkygh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f52B (B:)
    krfevkkwnavalwawdivvdncaicrnhimdlciecqanqasatsectvawgvcnhafh
    fhcisrwlktrqvcpldnrewefq
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4f52D (D:)
    gsmdvdtpsgtnsgagkkrfevkkwnavalwawdivvdncaicrnhimdlciecqanqas
    atseectvawgvcnhafhfhcisrwlktrqvcpldnrewefqkygh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f52D (D:)
    krfevkkwnavalwawdivvdncaicrnhimdlciecqanqasatseectvawgvcnhaf
    hfhcisrwlktrqvcpldnrewefq
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.