PDB entry 4f4r

View 4f4r on RCSB PDB site
Description: Crystal structure of D-mannonate dehydratase homolog from Chromohalobacter salexigens (Target EFI-502114), with bound NA, ordered loop
Class: lyase
Keywords: ENOLASE, ENZYME FUNCTION INITIATIVE, Structural Genomics, LYASE
Deposited on 2012-05-11, released 2012-06-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-06-27, with a file datestamp of 2012-06-22.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.146
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-mannonate dehydratase
    Species: Chromohalobacter salexigens [TaxId:290398]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (23-425)
      • expression tag (18-22)
    Domains in SCOPe 2.06: d4f4ra1, d4f4ra2, d4f4ra3
  • Heterogens: NA, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4f4rA (A:)
    mhhhhhhssgvdlgtenlyfqsmmkirdaytivtcpgrnfvtlkivtesgthgigdatln
    gremavaayldehvvpaligrdagriedtwqylyrgaywrrgpvtmtaiaavdmalwdik
    akaagmplyqllggksrervmtyahctgqtiedclgevarhvelgyravrvqsgvpgiet
    tygvaktpgeryepadsslpaehvwstekylnhapklfaavrerfgddlhvlhdvhhrlt
    pieaarlgkavepyhlfwledcvpaenqeslrlirehtttplaigevfnsihdcreliqn
    qwidyirmplthgggitamrrvadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfg
    iqehmphtdetdavfphdyrfedghflagespghgvdideelaakypyeraslpvnrled
    gtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f4rA (A:)
    yfqsmmkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpal
    igrdagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksre
    rvmtyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadss
    lpaehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfw
    ledcvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggita
    mrrvadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphd
    yrfedghflagespghgvdideelaakypyeraslpvnrledgtlwhw