PDB entry 4f4i

View 4f4i on RCSB PDB site
Description: Crystal structure of Thymidylate Kinase from Staphylococcus aureus in apo-form
Class: transferase
Keywords: Structural Genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, Midwest Center For Structural Genomics (Mcsg), Structures Of Mtb Proteins Conferring Susceptibility To Known Mtb Inhibitors (Mtbi), Thymidylate Kinase, TRANSFERASE
Deposited on 2012-05-10, released 2012-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidylate kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:158878]
    Gene: tmk, SAV0482
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4f4ia_
  • Chain 'B':
    Compound: thymidylate kinase
    Species: Staphylococcus aureus subsp. aureus [TaxId:158878]
    Gene: tmk, SAV0482
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4f4ib_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4f4iA (A:)
    mhhhhhhssgvdlgtenlyfqsnamsafitfegpegsgkttvinevyhrlvkdydvimtr
    epggvptgeeirkivlegndmdirteamlfaasrrehlvlkvipalkegkvvlcdryids
    slayqgyargigveevralnefainglypdltiylnvsaevgreriiknsrdqnrldqed
    lkfhekviegyqeiihnesqrfksvnadqplenvvedtyqtiikyleki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f4iA (A:)
    msafitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdir
    teamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefai
    nglypdltiylnvsaevgreriidqedlkfhekviegyqeiihsqrfksvnadqplenvv
    edtyqtiikylek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4f4iB (B:)
    mhhhhhhssgvdlgtenlyfqsnamsafitfegpegsgkttvinevyhrlvkdydvimtr
    epggvptgeeirkivlegndmdirteamlfaasrrehlvlkvipalkegkvvlcdryids
    slayqgyargigveevralnefainglypdltiylnvsaevgreriiknsrdqnrldqed
    lkfhekviegyqeiihnesqrfksvnadqplenvvedtyqtiikyleki
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f4iB (B:)
    safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
    eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
    glypdltiylnvsaevgreriiknsdqedlkfhekviegyqeiihnesqrfksvnadqpl
    envvedtyqtiikylek