PDB entry 4f3f

View 4f3f on RCSB PDB site
Description: Crystal Structure of Msln7-64 MORAb-009 FAB complex
Class: immune system
Keywords: Antibody Fab, Recognize mesothelin, mesothelin, IMMUNE SYSTEM
Deposited on 2012-05-09, released 2012-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-26, with a file datestamp of 2014-03-21.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.179
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MORAb-009 Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4F3F (0-End)
    Domains in SCOPe 2.07: d4f3fa1, d4f3fa2
  • Chain 'B':
    Compound: MORAb-009 Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4F3F (0-End)
  • Chain 'C':
    Compound: Mesothelin
    Species: Homo sapiens [TaxId:9606]
    Gene: MSLN, MPF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13421 (1-58)
      • expression tag (0)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4f3fA (A:)
    dieltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydtsklasgvpgr
    fsgsgsgnsysltissveaeddatyycqqwskhpltfgsgtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f3fA (A:)
    dieltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydtsklasgvpgr
    fsgsgsgnsysltissveaeddatyycqqwskhpltfgsgtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.