PDB entry 4f3b

View 4f3b on RCSB PDB site
Description: Glutamate bound to the D655A mutant of the ligand binding domain of GluA3
Class: transport protein/substrate
Keywords: glutamate receptor, GluA3, GluR3, AMPA receptor, S1S2, LBD, neurotransmitter receptor, glutamate, TRANSPORT PROTEIN-SUBSTRATE complex
Deposited on 2012-05-09, released 2012-05-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor 3
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Glur3, Gria3, Gria3; GluA3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19492 (0-113)
      • linker (114-115)
    • Uniprot P19492 (116-257)
      • engineered mutation (135)
    Domains in SCOPe 2.08: d4f3ba_
  • Heterogens: GLU, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4f3bA (A:)
rtivvttilespyvmykknheqlegneryegycvdlayeiakhvrikyklsivgdgkyga
rdpetkiwngmvgelvygradiavapltitlvreevidfskpfmslgisimikkgtpies
aedlakqteiaygtlasgstkeffrrskiavyekmwsymksaepsvftkttadgvarvrk
skgkfafllestmneyieqrkpcdtmkvggnldskgygvatpkgsalgnavnlavlklne
qglldklknkwwydkgec